Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | J9537_RS00885 | Genome accession | NZ_CP072888 |
| Coordinates | 165043..165480 (+) | Length | 145 a.a. |
| NCBI ID | WP_218256382.1 | Uniprot ID | - |
| Organism | Enterococcus raffinosus strain F162_2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 151906..197463 | 165043..165480 | within | 0 |
Gene organization within MGE regions
Location: 151906..197463
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J9537_RS00770 (J9537_00770) | recA | 151906..152955 (+) | 1050 | WP_218256362.1 | recombinase RecA | Machinery gene |
| J9537_RS00775 (J9537_00775) | rny | 153199..154755 (+) | 1557 | WP_010747259.1 | ribonuclease Y | - |
| J9537_RS00780 (J9537_00780) | - | 154835..155977 (-) | 1143 | WP_218256363.1 | site-specific integrase | - |
| J9537_RS00785 (J9537_00785) | - | 155990..156301 (-) | 312 | WP_218256364.1 | hypothetical protein | - |
| J9537_RS00790 (J9537_00790) | - | 156303..156473 (-) | 171 | WP_218256365.1 | hypothetical protein | - |
| J9537_RS00795 (J9537_00795) | - | 156580..157221 (-) | 642 | WP_218256366.1 | hypothetical protein | - |
| J9537_RS00800 (J9537_00800) | - | 157296..158000 (-) | 705 | WP_218256367.1 | XRE family transcriptional regulator | - |
| J9537_RS00805 (J9537_00805) | - | 158191..158403 (+) | 213 | WP_218256368.1 | helix-turn-helix transcriptional regulator | - |
| J9537_RS00810 (J9537_00810) | - | 158452..159213 (+) | 762 | WP_218256369.1 | phage antirepressor KilAC domain-containing protein | - |
| J9537_RS00815 (J9537_00815) | - | 159225..159530 (+) | 306 | WP_218256370.1 | hypothetical protein | - |
| J9537_RS00820 (J9537_00820) | - | 159544..159720 (+) | 177 | WP_218256371.1 | hypothetical protein | - |
| J9537_RS00825 (J9537_00825) | - | 159725..159907 (+) | 183 | WP_218256372.1 | hypothetical protein | - |
| J9537_RS00830 (J9537_00830) | - | 159900..160139 (-) | 240 | WP_218256373.1 | hypothetical protein | - |
| J9537_RS00835 (J9537_00835) | - | 160191..160343 (+) | 153 | WP_176673295.1 | hypothetical protein | - |
| J9537_RS00840 (J9537_00840) | - | 160420..160758 (-) | 339 | WP_218256374.1 | hypothetical protein | - |
| J9537_RS00845 (J9537_00845) | - | 160815..160961 (+) | 147 | WP_218256375.1 | hypothetical protein | - |
| J9537_RS00850 (J9537_00850) | - | 160997..161224 (+) | 228 | WP_218256376.1 | hypothetical protein | - |
| J9537_RS00855 (J9537_00855) | - | 161237..161773 (+) | 537 | WP_218256377.1 | host-nuclease inhibitor Gam family protein | - |
| J9537_RS00860 (J9537_00860) | - | 161775..162773 (+) | 999 | WP_144319158.1 | AAA family ATPase | - |
| J9537_RS00865 (J9537_00865) | - | 162778..163542 (+) | 765 | WP_218256378.1 | putative HNHc nuclease | - |
| J9537_RS00870 (J9537_00870) | - | 163532..164332 (+) | 801 | WP_218256379.1 | helix-turn-helix domain-containing protein | - |
| J9537_RS00875 (J9537_00875) | - | 164325..164633 (+) | 309 | WP_218256380.1 | hypothetical protein | - |
| J9537_RS00880 (J9537_00880) | - | 164630..165046 (+) | 417 | WP_218256381.1 | RusA family crossover junction endodeoxyribonuclease | - |
| J9537_RS00885 (J9537_00885) | ssb | 165043..165480 (+) | 438 | WP_218256382.1 | single-stranded DNA-binding protein | Machinery gene |
| J9537_RS00890 (J9537_00890) | - | 165492..165713 (+) | 222 | WP_218256383.1 | hypothetical protein | - |
| J9537_RS00895 (J9537_00895) | - | 165715..165981 (+) | 267 | WP_185969649.1 | hypothetical protein | - |
| J9537_RS00900 (J9537_00900) | - | 165983..166237 (+) | 255 | WP_218256384.1 | hypothetical protein | - |
| J9537_RS00905 (J9537_00905) | - | 166212..167213 (+) | 1002 | WP_218257301.1 | tyrosine-type recombinase/integrase | - |
| J9537_RS00910 (J9537_00910) | - | 167282..167548 (+) | 267 | WP_218256385.1 | hypothetical protein | - |
| J9537_RS00915 (J9537_00915) | - | 167615..167869 (+) | 255 | WP_218256386.1 | hypothetical protein | - |
| J9537_RS00920 (J9537_00920) | - | 167927..168664 (+) | 738 | WP_218256387.1 | hypothetical protein | - |
| J9537_RS00925 (J9537_00925) | - | 168689..169090 (+) | 402 | WP_218256388.1 | hypothetical protein | - |
| J9537_RS00930 (J9537_00930) | - | 169124..169543 (+) | 420 | WP_218256389.1 | hypothetical protein | - |
| J9537_RS00935 (J9537_00935) | - | 169574..170524 (+) | 951 | WP_218256390.1 | site-specific integrase | - |
| J9537_RS00940 (J9537_00940) | - | 170538..171056 (+) | 519 | WP_218256391.1 | hypothetical protein | - |
| J9537_RS00945 (J9537_00945) | - | 171059..171652 (+) | 594 | WP_218256392.1 | N-6 DNA methylase | - |
| J9537_RS00950 (J9537_00950) | - | 171720..171986 (+) | 267 | WP_218256393.1 | hypothetical protein | - |
| J9537_RS00955 (J9537_00955) | - | 172009..172458 (+) | 450 | WP_218256394.1 | hypothetical protein | - |
| J9537_RS00960 (J9537_00960) | - | 173363..173587 (+) | 225 | WP_218256395.1 | hypothetical protein | - |
| J9537_RS00965 (J9537_00965) | - | 173613..173969 (+) | 357 | WP_218256396.1 | phBC6A51 family helix-turn-helix protein | - |
| J9537_RS00970 (J9537_00970) | - | 173962..175245 (+) | 1284 | WP_245001305.1 | PBSX family phage terminase large subunit | - |
| J9537_RS00975 (J9537_00975) | - | 175258..176679 (+) | 1422 | WP_218256397.1 | phage portal protein | - |
| J9537_RS00980 (J9537_00980) | - | 176672..176875 (+) | 204 | WP_218256398.1 | hypothetical protein | - |
| J9537_RS00985 (J9537_00985) | - | 176880..177188 (+) | 309 | WP_218256399.1 | ribosomal-processing cysteine protease Prp | - |
| J9537_RS00990 (J9537_00990) | - | 177281..177502 (-) | 222 | WP_218256400.1 | hypothetical protein | - |
| J9537_RS00995 (J9537_00995) | - | 177580..178968 (+) | 1389 | WP_218256401.1 | minor capsid protein | - |
| J9537_RS01000 (J9537_01000) | - | 179032..179214 (+) | 183 | WP_245001270.1 | hypothetical protein | - |
| J9537_RS01005 (J9537_01005) | - | 179333..179971 (+) | 639 | WP_218256403.1 | DUF4355 domain-containing protein | - |
| J9537_RS01010 (J9537_01010) | - | 179987..181027 (+) | 1041 | WP_218256404.1 | major capsid protein | - |
| J9537_RS01015 (J9537_01015) | - | 181040..181387 (+) | 348 | WP_218256405.1 | phage head-tail connector protein | - |
| J9537_RS01020 (J9537_01020) | - | 181368..181721 (+) | 354 | WP_218256406.1 | hypothetical protein | - |
| J9537_RS01025 (J9537_01025) | - | 181711..182250 (+) | 540 | WP_218256407.1 | HK97 gp10 family phage protein | - |
| J9537_RS01030 (J9537_01030) | - | 182247..182612 (+) | 366 | WP_010743585.1 | hypothetical protein | - |
| J9537_RS01035 (J9537_01035) | - | 182628..183065 (+) | 438 | WP_218256408.1 | phage tail protein | - |
| J9537_RS01040 (J9537_01040) | - | 183136..183507 (+) | 372 | WP_218256409.1 | DUF6096 family protein | - |
| J9537_RS01045 (J9537_01045) | - | 183540..183887 (+) | 348 | WP_185937995.1 | hypothetical protein | - |
| J9537_RS20570 | - | 183891..185417 (+) | 1527 | WP_245001271.1 | hypothetical protein | - |
| J9537_RS01050 (J9537_01050) | - | 185305..188550 (+) | 3246 | WP_245001272.1 | hypothetical protein | - |
| J9537_RS01055 (J9537_01055) | - | 188563..188922 (+) | 360 | WP_016178327.1 | DUF6711 family protein | - |
| J9537_RS01060 (J9537_01060) | - | 188934..191543 (+) | 2610 | WP_218256410.1 | gp58-like family protein | - |
| J9537_RS01065 (J9537_01065) | - | 191540..191698 (+) | 159 | WP_218256411.1 | hypothetical protein | - |
| J9537_RS01070 (J9537_01070) | - | 191699..193240 (+) | 1542 | WP_218256412.1 | hypothetical protein | - |
| J9537_RS01075 (J9537_01075) | - | 193307..193579 (+) | 273 | WP_195967677.1 | hypothetical protein | - |
| J9537_RS01080 (J9537_01080) | - | 193613..193819 (+) | 207 | WP_218256413.1 | phage holin | - |
| J9537_RS01085 (J9537_01085) | - | 193831..194835 (+) | 1005 | WP_218256414.1 | N-acetylmuramoyl-L-alanine amidase | - |
| J9537_RS01095 (J9537_01095) | - | 195387..196034 (+) | 648 | WP_218256415.1 | hypothetical protein | - |
| J9537_RS01100 (J9537_01100) | - | 196027..196449 (+) | 423 | WP_218256416.1 | hypothetical protein | - |
| J9537_RS01105 (J9537_01105) | - | 196779..197048 (-) | 270 | WP_218256417.1 | hypothetical protein | - |
| J9537_RS01110 (J9537_01110) | - | 197059..197463 (-) | 405 | WP_218256418.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16208.73 Da Isoelectric Point: 4.6968
>NTDB_id=556622 J9537_RS00885 WP_218256382.1 165043..165480(+) (ssb) [Enterococcus raffinosus strain F162_2]
MINNVVLVGRLTADPNLRYTASGTGVATFTLAVNRNFTNQDGNREADFINCVIWRKSAETLANYARKGTLIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESRSNNEKRQDDKSQQNTNTNNVESDPFNGSSIDIGDDDLPF
MINNVVLVGRLTADPNLRYTASGTGVATFTLAVNRNFTNQDGNREADFINCVIWRKSAETLANYARKGTLIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQLLESRSNNEKRQDDKSQQNTNTNNVESDPFNGSSIDIGDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=556622 J9537_RS00885 WP_218256382.1 165043..165480(+) (ssb) [Enterococcus raffinosus strain F162_2]
ATGATAAACAATGTGGTTCTAGTAGGAAGGTTAACGGCTGATCCAAACCTACGATATACAGCGAGCGGCACCGGGGTTGC
TACATTCACTCTAGCAGTGAACAGAAATTTCACGAATCAAGATGGAAATCGAGAAGCTGACTTCATCAATTGTGTGATTT
GGCGTAAGTCTGCAGAGACACTAGCGAACTATGCACGAAAAGGAACATTGATTGGTGTAACAGGACGTATCCAAACACGA
AATTATGAAAATCAGCAGGGCCAACGTGTCTATGTGACAGAAGTTGTTGCTGACAATTTCCAGTTATTGGAATCTCGTAG
TAACAATGAGAAACGTCAAGATGATAAGTCACAGCAGAATACAAATACAAACAATGTGGAGTCTGATCCATTCAATGGTT
CATCGATCGATATTGGTGACGACGATCTGCCGTTCTAG
ATGATAAACAATGTGGTTCTAGTAGGAAGGTTAACGGCTGATCCAAACCTACGATATACAGCGAGCGGCACCGGGGTTGC
TACATTCACTCTAGCAGTGAACAGAAATTTCACGAATCAAGATGGAAATCGAGAAGCTGACTTCATCAATTGTGTGATTT
GGCGTAAGTCTGCAGAGACACTAGCGAACTATGCACGAAAAGGAACATTGATTGGTGTAACAGGACGTATCCAAACACGA
AATTATGAAAATCAGCAGGGCCAACGTGTCTATGTGACAGAAGTTGTTGCTGACAATTTCCAGTTATTGGAATCTCGTAG
TAACAATGAGAAACGTCAAGATGATAAGTCACAGCAGAATACAAATACAAACAATGTGGAGTCTGATCCATTCAATGGTT
CATCGATCGATATTGGTGACGACGATCTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
61.176 |
100 |
0.717 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.628 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.207 |
100 |
0.462 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.018 |
78.621 |
0.448 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.448 |
100 |
0.434 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.759 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.759 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.759 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.759 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.759 |
100 |
0.428 |
| ssbA | Streptococcus mutans UA159 |
42.069 |
100 |
0.421 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
46.903 |
77.931 |
0.366 |