Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | JZP77_RS05190 | Genome accession | NZ_CP071172 |
| Coordinates | 1084030..1084305 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain L13 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1084329..1136738 | 1084030..1084305 | flank | 24 |
Gene organization within MGE regions
Location: 1084030..1136738
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JZP77_RS05190 (JZP77_05190) | comGC/cglC | 1084030..1084305 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| JZP77_RS05195 (JZP77_05195) | comGD | 1084302..1084745 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| JZP77_RS05200 (JZP77_05200) | - | 1084773..1085921 (-) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| JZP77_RS05205 (JZP77_05205) | - | 1085996..1086325 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| JZP77_RS05210 (JZP77_05210) | - | 1086340..1087104 (-) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| JZP77_RS05215 (JZP77_05215) | - | 1087222..1087860 (-) | 639 | WP_002389292.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JZP77_RS05220 (JZP77_05220) | - | 1087873..1088217 (-) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| JZP77_RS05225 (JZP77_05225) | - | 1088508..1088699 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| JZP77_RS05230 (JZP77_05230) | - | 1088705..1089022 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| JZP77_RS05235 (JZP77_05235) | - | 1089061..1089782 (+) | 722 | Protein_1022 | Rha family transcriptional regulator | - |
| JZP77_RS05240 (JZP77_05240) | - | 1089822..1090004 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| JZP77_RS05245 (JZP77_05245) | - | 1090057..1090251 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| JZP77_RS05250 (JZP77_05250) | - | 1090242..1090427 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| JZP77_RS05255 (JZP77_05255) | - | 1090471..1090794 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| JZP77_RS05260 (JZP77_05260) | - | 1090794..1091021 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| JZP77_RS05265 (JZP77_05265) | - | 1091119..1092063 (+) | 945 | WP_002389314.1 | YqaJ viral recombinase family protein | - |
| JZP77_RS05270 (JZP77_05270) | - | 1092063..1092956 (+) | 894 | WP_002369907.1 | recombinase RecT | - |
| JZP77_RS05275 (JZP77_05275) | - | 1092993..1093994 (+) | 1002 | WP_002389256.1 | Lin1244/Lin1753 domain-containing protein | - |
| JZP77_RS05280 (JZP77_05280) | - | 1093998..1094300 (+) | 303 | WP_002389299.1 | hypothetical protein | - |
| JZP77_RS05285 (JZP77_05285) | - | 1094301..1094600 (+) | 300 | WP_002389080.1 | MazG-like family protein | - |
| JZP77_RS05290 (JZP77_05290) | - | 1094618..1095043 (+) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JZP77_RS05295 (JZP77_05295) | - | 1095950..1096366 (+) | 417 | WP_010816133.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JZP77_RS05305 (JZP77_05305) | - | 1097360..1097593 (+) | 234 | WP_002389079.1 | hypothetical protein | - |
| JZP77_RS05310 (JZP77_05310) | - | 1097737..1098315 (+) | 579 | WP_002370953.1 | sce7726 family protein | - |
| JZP77_RS05315 (JZP77_05315) | - | 1098353..1099270 (-) | 918 | WP_002370955.1 | beta family protein | - |
| JZP77_RS05320 (JZP77_05320) | terS | 1099539..1100342 (+) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| JZP77_RS05325 (JZP77_05325) | - | 1100314..1101603 (+) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| JZP77_RS05330 (JZP77_05330) | - | 1101615..1103102 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| JZP77_RS05335 (JZP77_05335) | - | 1103077..1104834 (+) | 1758 | WP_002384360.1 | head protein | - |
| JZP77_RS05340 (JZP77_05340) | - | 1104831..1105052 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| JZP77_RS05345 (JZP77_05345) | - | 1105117..1105437 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| JZP77_RS05350 (JZP77_05350) | - | 1105655..1106278 (+) | 624 | WP_002389133.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| JZP77_RS05355 (JZP77_05355) | - | 1106292..1107179 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| JZP77_RS05360 (JZP77_05360) | - | 1107208..1107390 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| JZP77_RS05365 (JZP77_05365) | - | 1107404..1107748 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| JZP77_RS05370 (JZP77_05370) | - | 1107745..1108113 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| JZP77_RS05375 (JZP77_05375) | - | 1108106..1108504 (+) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| JZP77_RS05380 (JZP77_05380) | - | 1108507..1108881 (+) | 375 | WP_002357037.1 | phage tail terminator family protein | - |
| JZP77_RS05385 (JZP77_05385) | - | 1108882..1109730 (+) | 849 | WP_002384363.1 | major tail protein | - |
| JZP77_RS05390 (JZP77_05390) | gpG | 1109783..1110133 (+) | 351 | WP_002370959.1 | phage tail assembly chaperone G | - |
| JZP77_RS05395 (JZP77_05395) | - | 1110381..1113278 (+) | 2898 | WP_002393612.1 | tape measure protein | - |
| JZP77_RS05400 (JZP77_05400) | - | 1113268..1114002 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| JZP77_RS05405 (JZP77_05405) | - | 1113984..1116791 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| JZP77_RS05410 (JZP77_05410) | - | 1116810..1117691 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| JZP77_RS05415 (JZP77_05415) | - | 1117684..1118280 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| JZP77_RS05420 (JZP77_05420) | - | 1118277..1118564 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| JZP77_RS05425 (JZP77_05425) | - | 1118564..1119055 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| JZP77_RS05430 (JZP77_05430) | - | 1119069..1119389 (+) | 321 | WP_002389262.1 | hypothetical protein | - |
| JZP77_RS05435 (JZP77_05435) | - | 1119391..1119546 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| JZP77_RS05440 (JZP77_05440) | - | 1119581..1119802 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| JZP77_RS05445 (JZP77_05445) | - | 1119795..1120028 (+) | 234 | WP_002384371.1 | phage holin | - |
| JZP77_RS05450 (JZP77_05450) | - | 1120029..1121270 (+) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| JZP77_RS05455 (JZP77_05455) | - | 1122107..1122307 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| JZP77_RS05460 (JZP77_05460) | - | 1122379..1122651 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| JZP77_RS05470 (JZP77_05470) | hemH | 1123367..1124308 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| JZP77_RS05475 (JZP77_05475) | - | 1125110..1125436 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| JZP77_RS05480 (JZP77_05480) | comGF | 1125426..1125860 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| JZP77_RS05485 (JZP77_05485) | comGG | 1125860..1126213 (+) | 354 | WP_094467184.1 | competence type IV pilus minor pilin ComGG | - |
| JZP77_RS05490 (JZP77_05490) | - | 1126342..1127349 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| JZP77_RS05495 (JZP77_05495) | - | 1127374..1128561 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| JZP77_RS05500 (JZP77_05500) | - | 1128673..1129146 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| JZP77_RS05505 (JZP77_05505) | - | 1129462..1129794 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| JZP77_RS05515 (JZP77_05515) | - | 1130068..1131345 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| JZP77_RS05520 (JZP77_05520) | - | 1131474..1132151 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| JZP77_RS05525 (JZP77_05525) | - | 1132108..1132593 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| JZP77_RS05530 (JZP77_05530) | prmA | 1132609..1133556 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| JZP77_RS05535 (JZP77_05535) | - | 1133558..1134310 (+) | 753 | WP_002378439.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| JZP77_RS05540 (JZP77_05540) | - | 1134525..1136738 (+) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=543427 JZP77_RS05190 WP_002356991.1 1084030..1084305(+) (comGC/cglC) [Enterococcus faecalis strain L13]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=543427 JZP77_RS05190 WP_002356991.1 1084030..1084305(+) (comGC/cglC) [Enterococcus faecalis strain L13]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |