Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | JO410_RS08640 | Genome accession | NZ_CP069185 |
| Coordinates | 1762201..1762476 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain L11 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1757201..1767476
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JO410_RS08595 (JO410_08595) | - | 1757237..1757419 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| JO410_RS08600 (JO410_08600) | - | 1757459..1758184 (-) | 726 | WP_174092948.1 | Rha family transcriptional regulator | - |
| JO410_RS08605 (JO410_08605) | - | 1758223..1758534 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| JO410_RS08610 (JO410_08610) | - | 1758545..1758721 (-) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| JO410_RS08615 (JO410_08615) | - | 1759033..1759365 (+) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| JO410_RS08620 (JO410_08620) | - | 1759382..1759726 (+) | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JO410_RS08625 (JO410_08625) | - | 1759760..1760488 (+) | 729 | WP_002364358.1 | ion transporter | - |
| JO410_RS08630 (JO410_08630) | - | 1760585..1761733 (+) | 1149 | WP_002364359.1 | tyrosine-type recombinase/integrase | - |
| JO410_RS08635 (JO410_08635) | comGD | 1761761..1762204 (-) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| JO410_RS08640 (JO410_08640) | comGC/cglC | 1762201..1762476 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| JO410_RS08645 (JO410_08645) | comGB | 1762476..1763522 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| JO410_RS08650 (JO410_08650) | comGA | 1763479..1764447 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| JO410_RS08655 (JO410_08655) | - | 1764688..1766016 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| JO410_RS08660 (JO410_08660) | rlmN | 1766306..1767379 (-) | 1074 | WP_002378471.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=532791 JO410_RS08640 WP_002356991.1 1762201..1762476(-) (comGC/cglC) [Enterococcus faecalis strain L11]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=532791 JO410_RS08640 WP_002356991.1 1762201..1762476(-) (comGC/cglC) [Enterococcus faecalis strain L11]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |