Detailed information NTG0530494

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC073_RS11765
• Genome accession: NZ_CP068698
• Coordinates: 2268983..2269333 (-)
• Length: 116 a.a.
• NCBI ID: WP_050574401.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain UC073
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2263059..2271160	2268983..2269333	within	0

Gene organization within MGE regions

Location: 2263059..2271160

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC073_RS11725 (LLUC073_11460)	-	2264519..2265328 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC073_RS11730 (LLUC073_11465)	-	2265321..2266058 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUC073_RS11735 (LLUC073_11470)	-	2266237..2267079 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC073_RS11740 (LLUC073_11475)	-	2267076..2267513 (-)	438	WP_282670666.1	zinc-dependent MarR family transcriptional regulator	-
LLUC073_RS11745 (LLUC073_11480)	comGG	2267593..2267892 (-)	300	WP_282670667.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC073_RS11750 (LLUC073_11485)	comGF	2267916..2268341 (-)	426	WP_014735174.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC073_RS11755 (LLUC073_11490)	comGE	2268325..2268561 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC073_RS11760 (LLUC073_14140)	comGD	2268593..2268781 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC073_RS11765 (LLUC073_11500)	comGC	2268983..2269333 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC073_RS11770 (LLUC073_11505)	comGB	2269378..2270403 (-)	1026	WP_050574400.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC073_RS11775 (LLUC073_11510)	comGA	2270303..2271160 (-)	858	WP_318299077.1	ATPase, T2SS/T4P/T4SS family	Machinery gene

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13289.44 Da
• Isoelectric Point: 7.2003

>NTDB_id=530494 LLUC073_RS11765 WP_050574401.1 2268983..2269333(-) (comGC) [Lactococcus cremoris strain UC073]
MSKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD

Nucleotide

• Length: 351 bp

>NTDB_id=530494 LLUC073_RS11765 WP_050574401.1 2268983..2269333(-) (comGC) [Lactococcus cremoris strain UC073]
ATGAGCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAGCTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (18-41)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	98.276	100	0.983
comYC	Streptococcus gordonii str. Challis substr. CH1	58.586	85.345	0.5
comGC/cglC	Streptococcus mitis SK321	55.882	87.931	0.491
comGC/cglC	Streptococcus pneumoniae R6	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae D39	53.922	87.931	0.474
comYC	Streptococcus mutans UA140	59.14	80.172	0.474
comYC	Streptococcus mutans UA159	59.14	80.172	0.474
comGC/cglC	Streptococcus mitis NCTC 12261	55.67	83.621	0.466
comYC	Streptococcus suis isolate S10	56.818	75.862	0.431