Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LLUC073_RS11745 Genome accession   NZ_CP068698
Coordinates   2267593..2267892 (-) Length   99 a.a.
NCBI ID   WP_282670667.1    Uniprot ID   -
Organism   Lactococcus cremoris strain UC073     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 2263059..2271160 2267593..2267892 within 0


Gene organization within MGE regions


Location: 2263059..2271160
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC073_RS11725 (LLUC073_11460) - 2264519..2265328 (-) 810 WP_011677177.1 metal ABC transporter permease -
  LLUC073_RS11730 (LLUC073_11465) - 2265321..2266058 (-) 738 WP_011677178.1 metal ABC transporter ATP-binding protein -
  LLUC073_RS11735 (LLUC073_11470) - 2266237..2267079 (-) 843 WP_011677179.1 metal ABC transporter solute-binding protein, Zn/Mn family -
  LLUC073_RS11740 (LLUC073_11475) - 2267076..2267513 (-) 438 WP_282670666.1 zinc-dependent MarR family transcriptional regulator -
  LLUC073_RS11745 (LLUC073_11480) comGG 2267593..2267892 (-) 300 WP_282670667.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC073_RS11750 (LLUC073_11485) comGF 2267916..2268341 (-) 426 WP_014735174.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC073_RS11755 (LLUC073_11490) comGE 2268325..2268561 (-) 237 WP_014573335.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC073_RS11760 (LLUC073_14140) comGD 2268593..2268781 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLUC073_RS11765 (LLUC073_11500) comGC 2268983..2269333 (-) 351 WP_050574401.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC073_RS11770 (LLUC073_11505) comGB 2269378..2270403 (-) 1026 WP_050574400.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUC073_RS11775 (LLUC073_11510) comGA 2270303..2271160 (-) 858 WP_318299077.1 ATPase, T2SS/T4P/T4SS family Machinery gene

Sequence

Protein


Download         Length: 99 a.a.        Molecular weight: 11274.25 Da        Isoelectric Point: 9.5415

>NTDB_id=530490 LLUC073_RS11745 WP_282670667.1 2267593..2267892(-) (comGG) [Lactococcus cremoris strain UC073]
MVFLLIFSLFLQFYLQKQVLTAQQLKIEKERLTAELMVSLALKKDLKTSGQLNFDCGNLTYKLLTDLSADSTSGGQTVSN
KTYCFDVRLKDGRIFQIVK

Nucleotide


Download         Length: 300 bp        

>NTDB_id=530490 LLUC073_RS11745 WP_282670667.1 2267593..2267892(-) (comGG) [Lactococcus cremoris strain UC073]
TTGGTTTTTCTGCTAATTTTTTCTTTATTTCTACAGTTTTATTTGCAAAAACAGGTGCTTACAGCTCAGCAATTGAAAAT
AGAAAAGGAGCGACTGACAGCCGAATTAATGGTTTCATTGGCTCTTAAAAAGGATTTGAAAACGAGTGGTCAACTTAATT
TTGATTGTGGAAATTTAACTTACAAATTACTGACAGATCTGTCAGCTGATTCAACTAGCGGTGGTCAAACTGTTAGTAAT
AAAACTTATTGTTTTGATGTTCGGCTTAAGGATGGAAGAATTTTTCAAATAGTAAAGTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

97.98

100

0.98