Detailed information NTG0530491

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: LLUC073_RS11750
• Genome accession: NZ_CP068698
• Coordinates: 2267916..2268341 (-)
• Length: 141 a.a.
• NCBI ID: WP_014735174.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain UC073
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2263059..2271160	2267916..2268341	within	0

Gene organization within MGE regions

Location: 2263059..2271160

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC073_RS11725 (LLUC073_11460)	-	2264519..2265328 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC073_RS11730 (LLUC073_11465)	-	2265321..2266058 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUC073_RS11735 (LLUC073_11470)	-	2266237..2267079 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC073_RS11740 (LLUC073_11475)	-	2267076..2267513 (-)	438	WP_282670666.1	zinc-dependent MarR family transcriptional regulator	-
LLUC073_RS11745 (LLUC073_11480)	comGG	2267593..2267892 (-)	300	WP_282670667.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC073_RS11750 (LLUC073_11485)	comGF	2267916..2268341 (-)	426	WP_014735174.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC073_RS11755 (LLUC073_11490)	comGE	2268325..2268561 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC073_RS11760 (LLUC073_14140)	comGD	2268593..2268781 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC073_RS11765 (LLUC073_11500)	comGC	2268983..2269333 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC073_RS11770 (LLUC073_11505)	comGB	2269378..2270403 (-)	1026	WP_050574400.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC073_RS11775 (LLUC073_11510)	comGA	2270303..2271160 (-)	858	WP_318299077.1	ATPase, T2SS/T4P/T4SS family	Machinery gene

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 16210.78 Da
• Isoelectric Point: 8.4549

>NTDB_id=530491 LLUC073_RS11750 WP_014735174.1 2267916..2268341(-) (comGF) [Lactococcus cremoris strain UC073]
MKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGAKLDNVNQNFLYVTKDKK
LRFGLVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK

Nucleotide

• Length: 426 bp

>NTDB_id=530491 LLUC073_RS11750 WP_014735174.1 2267916..2268341(-) (comGF) [Lactococcus cremoris strain UC073]
TTGAAGCTCAAAATTAGGGCATTTACTTTACTTGAATGTCTCGTAGCACTTTTGGCAATTTCTGGTTCAGTGCTAGTCAT
CTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGAAAGATTGGCAAATATTTTGTG
AACAAATGCGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTGTATGTGACCAAAGATAAGAAG
TTACGGTTCGGATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATACCAACCGATGCTTTATGATTT
AAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATAATGGAGGTGAGCGAGTATTTA
TTTATCGATTTACTGATACAAAGTAA

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (38-130)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Lactococcus lactis subsp. cremoris KW2	100	100	1
comYF	Streptococcus mutans UA140	43.972	100	0.44
comYF	Streptococcus mutans UA159	43.262	100	0.433
comGF/cglF	Streptococcus mitis NCTC 12261	39.286	99.291	0.39
comGF/cglF	Streptococcus mitis SK321	39.286	99.291	0.39
comGF/cglF	Streptococcus pneumoniae Rx1	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae D39	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae R6	37.857	99.291	0.376
comGF/cglF	Streptococcus pneumoniae TIGR4	37.857	99.291	0.376