Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | JG557_RS05215 | Genome accession | NZ_CP068249 |
| Coordinates | 1088190..1088465 (+) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain T90-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1088489..1141952 | 1088190..1088465 | flank | 24 |
Gene organization within MGE regions
Location: 1088190..1141952
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JG557_RS05215 (JG557_05215) | comGC/cglC | 1088190..1088465 (+) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| JG557_RS05220 (JG557_05220) | comGD | 1088462..1088905 (+) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| JG557_RS05225 (JG557_05225) | - | 1088933..1090081 (-) | 1149 | WP_002389015.1 | site-specific integrase | - |
| JG557_RS05230 (JG557_05230) | - | 1090156..1090485 (-) | 330 | WP_002369911.1 | hypothetical protein | - |
| JG557_RS05235 (JG557_05235) | - | 1090500..1091264 (-) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| JG557_RS05240 (JG557_05240) | - | 1091382..1092029 (-) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JG557_RS05245 (JG557_05245) | - | 1092034..1092378 (-) | 345 | WP_002384346.1 | helix-turn-helix domain-containing protein | - |
| JG557_RS05250 (JG557_05250) | - | 1092669..1092860 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| JG557_RS05255 (JG557_05255) | - | 1092866..1093183 (+) | 318 | WP_002364228.1 | hypothetical protein | - |
| JG557_RS05260 (JG557_05260) | - | 1093222..1093944 (+) | 723 | WP_002364225.1 | phage regulatory protein | - |
| JG557_RS05265 (JG557_05265) | - | 1093984..1094166 (-) | 183 | WP_002364224.1 | YegP family protein | - |
| JG557_RS05270 (JG557_05270) | - | 1094219..1094413 (+) | 195 | WP_002364223.1 | hypothetical protein | - |
| JG557_RS05275 (JG557_05275) | - | 1094404..1094589 (+) | 186 | WP_002364222.1 | hypothetical protein | - |
| JG557_RS05280 (JG557_05280) | - | 1094633..1094956 (+) | 324 | WP_002369793.1 | hypothetical protein | - |
| JG557_RS05285 (JG557_05285) | - | 1094956..1095183 (+) | 228 | WP_002364220.1 | hypothetical protein | - |
| JG557_RS05290 (JG557_05290) | - | 1095281..1096222 (+) | 942 | WP_002364219.1 | YqaJ viral recombinase family protein | - |
| JG557_RS05295 (JG557_05295) | - | 1096225..1097115 (+) | 891 | WP_002364218.1 | recombinase RecT | - |
| JG557_RS05300 (JG557_05300) | - | 1097129..1098091 (+) | 963 | WP_002392261.1 | Lin1244/Lin1753 domain-containing protein | - |
| JG557_RS05305 (JG557_05305) | - | 1098095..1098397 (+) | 303 | WP_002364215.1 | hypothetical protein | - |
| JG557_RS05310 (JG557_05310) | - | 1098398..1098697 (+) | 300 | WP_002392260.1 | MazG-like family protein | - |
| JG557_RS05315 (JG557_05315) | - | 1098715..1099138 (+) | 424 | Protein_1026 | RusA family crossover junction endodeoxyribonuclease | - |
| JG557_RS05320 (JG557_05320) | - | 1100045..1100461 (+) | 417 | WP_002364209.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| JG557_RS05330 (JG557_05330) | - | 1100992..1101606 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| JG557_RS05335 (JG557_05335) | - | 1102323..1103045 (+) | 723 | WP_002392259.1 | DUF5677 domain-containing protein | - |
| JG557_RS05340 (JG557_05340) | terS | 1103092..1103895 (+) | 804 | WP_002364203.1 | phage terminase small subunit | - |
| JG557_RS05345 (JG557_05345) | - | 1103867..1105156 (+) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| JG557_RS05350 (JG557_05350) | - | 1105168..1106655 (+) | 1488 | WP_002384358.1 | phage portal protein | - |
| JG557_RS05355 (JG557_05355) | - | 1106630..1108387 (+) | 1758 | WP_002392258.1 | head protein | - |
| JG557_RS05360 (JG557_05360) | - | 1108384..1108605 (+) | 222 | WP_002357027.1 | hypothetical protein | - |
| JG557_RS05365 (JG557_05365) | - | 1108670..1108990 (+) | 321 | WP_002389265.1 | hypothetical protein | - |
| JG557_RS05370 (JG557_05370) | - | 1109208..1109831 (+) | 624 | WP_002389133.1 | DUF4355 domain-containing protein | - |
| JG557_RS05375 (JG557_05375) | - | 1109845..1110732 (+) | 888 | WP_002392257.1 | DUF5309 domain-containing protein | - |
| JG557_RS05380 (JG557_05380) | - | 1110761..1110943 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| JG557_RS05385 (JG557_05385) | - | 1110957..1111301 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| JG557_RS05390 (JG557_05390) | - | 1111298..1111666 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| JG557_RS15505 | - | 1111659..1111742 (+) | 84 | Protein_1041 | HK97 gp10 family phage protein | - |
| JG557_RS05395 (JG557_05395) | - | 1111880..1113130 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| JG557_RS05400 (JG557_05400) | - | 1113484..1113828 (+) | 345 | WP_002392208.1 | HK97 gp10 family phage protein | - |
| JG557_RS05405 (JG557_05405) | - | 1113831..1114205 (+) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| JG557_RS05410 (JG557_05410) | - | 1114206..1115054 (+) | 849 | WP_002384363.1 | major tail protein | - |
| JG557_RS05415 (JG557_05415) | gpG | 1115107..1115457 (+) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| JG557_RS05420 (JG557_05420) | - | 1115705..1118602 (+) | 2898 | WP_002392207.1 | tape measure protein | - |
| JG557_RS05425 (JG557_05425) | - | 1118592..1119326 (+) | 735 | WP_002357042.1 | hypothetical protein | - |
| JG557_RS05430 (JG557_05430) | - | 1119308..1122115 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| JG557_RS05435 (JG557_05435) | - | 1122134..1123015 (+) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| JG557_RS05440 (JG557_05440) | - | 1123008..1123604 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| JG557_RS05445 (JG557_05445) | - | 1123601..1123888 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| JG557_RS05450 (JG557_05450) | - | 1123888..1124379 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| JG557_RS05455 (JG557_05455) | - | 1124393..1124713 (+) | 321 | WP_010774127.1 | hypothetical protein | - |
| JG557_RS05460 (JG557_05460) | - | 1124715..1124870 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| JG557_RS05465 (JG557_05465) | - | 1124905..1125126 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| JG557_RS05470 (JG557_05470) | - | 1125119..1125352 (+) | 234 | WP_002384371.1 | phage holin | - |
| JG557_RS05475 (JG557_05475) | - | 1125353..1126594 (+) | 1242 | WP_002392204.1 | LysM peptidoglycan-binding domain-containing protein | - |
| JG557_RS05480 (JG557_05480) | - | 1127459..1127659 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| JG557_RS05485 (JG557_05485) | - | 1127731..1128003 (+) | 273 | WP_002370964.1 | hypothetical protein | - |
| JG557_RS05495 (JG557_05495) | hemH | 1128719..1129660 (+) | 942 | WP_033606971.1 | ferrochelatase | - |
| JG557_RS15445 | - | 1129958..1130083 (-) | 126 | WP_002357058.1 | hypothetical protein | - |
| JG557_RS05500 (JG557_05500) | - | 1130462..1130788 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| JG557_RS05505 (JG557_05505) | comGF | 1130778..1131212 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| JG557_RS05510 (JG557_05510) | comGG | 1131212..1131565 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| JG557_RS05515 (JG557_05515) | - | 1131694..1132701 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| JG557_RS05520 (JG557_05520) | - | 1132726..1133913 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| JG557_RS05525 (JG557_05525) | - | 1134025..1134498 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| JG557_RS05530 (JG557_05530) | - | 1134676..1134954 (-) | 279 | WP_002380425.1 | hypothetical protein | - |
| JG557_RS05540 (JG557_05540) | - | 1135282..1136559 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| JG557_RS05545 (JG557_05545) | - | 1136688..1137365 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| JG557_RS05550 (JG557_05550) | - | 1137322..1137807 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| JG557_RS05555 (JG557_05555) | prmA | 1137823..1138770 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| JG557_RS05560 (JG557_05560) | - | 1138772..1139524 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| JG557_RS05565 (JG557_05565) | - | 1139739..1141952 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=528597 JG557_RS05215 WP_002364235.1 1088190..1088465(+) (comGC/cglC) [Enterococcus faecalis strain T90-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=528597 JG557_RS05215 WP_002364235.1 1088190..1088465(+) (comGC/cglC) [Enterococcus faecalis strain T90-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |