NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	JCR32_RS10555	Genome accession	NZ_CP067069
Coordinates	2062775..2063110 (+)	Length	111 a.a.
NCBI ID	WP_274431366.1	Uniprot ID	-
Organism	Bacillus sp. HNR-4
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 2057775..2068110

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
JCR32_RS10525 (JCR32_10495)	-	2057793..2057984 (+)	192	WP_076869838.1	DUF3954 domain-containing protein	-
JCR32_RS10530 (JCR32_10500)	-	2058093..2058800 (-)	708	WP_274431364.1	hypothetical protein	-
JCR32_RS10535 (JCR32_10505)	-	2058910..2059557 (+)	648	WP_000165940.1	HD domain-containing protein	-
JCR32_RS10540 (JCR32_10510)	-	2059554..2061449 (+)	1896	WP_274431365.1	ABC-F family ATP-binding cassette domain-containing protein	-
JCR32_RS10545 (JCR32_10515)	-	2061525..2062256 (+)	732	WP_001260642.1	Bax inhibitor-1/YccA family protein	-
JCR32_RS10550 (JCR32_10520)	-	2062362..2062616 (+)	255	WP_000975123.1	DUF4318 domain-containing protein	-
JCR32_RS10555 (JCR32_10525)	ssbA	2062775..2063110 (+)	336	WP_274431366.1	single-stranded DNA-binding protein	Machinery gene
JCR32_RS10560 (JCR32_10530)	-	2063139..2063729 (-)	591	WP_076869836.1	TetR/AcrR family transcriptional regulator	-
JCR32_RS10565 (JCR32_10535)	-	2063852..2064985 (-)	1134	WP_001066846.1	FAD-dependent monooxygenase	-
JCR32_RS10570 (JCR32_10540)	-	2065244..2066371 (+)	1128	WP_274431367.1	conserved virulence factor C family protein	-
JCR32_RS10575 (JCR32_10545)	-	2066375..2066758 (+)	384	WP_274431368.1	DCC1-like thiol-disulfide oxidoreductase family protein	-
JCR32_RS10580 (JCR32_10550)	-	2066842..2067276 (+)	435	WP_000063712.1	BrxA/BrxB family bacilliredoxin	-
JCR32_RS10585 (JCR32_10555)	-	2067326..2067880 (+)	555	Protein_2000	class I SAM-dependent methyltransferase	-

Sequence

Protein

Download Length: 111 a.a. Molecular weight: 12793.62 Da Isoelectric Point: 9.1002

                                >NTDB_id=524806 JCR32_RS10555 WP_274431366.1 2062775..2063110(+) (ssbA) [Bacillus sp. HNR-4]

MMNRVVLIGRLTKEPELYYTKQGVAYARVCVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTR

NYEDDQGKRIYITEVVIESITFLERRREGAS

Nucleotide

Download Length: 336 bp

                                >NTDB_id=524806 JCR32_RS10555 WP_274431366.1 2062775..2063110(+) (ssbA) [Bacillus sp. HNR-4]

ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAGCAAGGCGTCGCGTATGC

ACGAGTATGTGTTGCGGTGAATAGAGGTTTTCGAAATAGCTTAGGTGAGCAGCAAGTAGATTTTATTAATTGCGTCGTAT

GGAGAAGGTCAGCTGAGAATGTAACTGAATATTGTACGAAAGGGTCTCTTGTTGGAATTACCGGACGTATTCATACGAGG

AATTACGAGGATGATCAAGGAAAGAGAATATATATAACGGAAGTTGTGATTGAGAGCATTACATTTTTGGAGAGAAGGAG

GGAGGGCGCATCGTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.434	95.495	0.568
ssb	Latilactobacillus sakei subsp. sakei 23K	54.717	95.495	0.523
ssbB	Bacillus subtilis subsp. subtilis str. 168	50.893	100	0.514
ssbB	Lactococcus lactis subsp. cremoris KW2	46.667	94.595	0.441
ssbA	Streptococcus mutans UA159	44.545	99.099	0.441
ssbB	Streptococcus sobrinus strain NIDR 6715-7	44.545	99.099	0.441
ssbB/cilA	Streptococcus pneumoniae TIGR4	43.636	99.099	0.432
ssbB/cilA	Streptococcus pneumoniae Rx1	42.727	99.099	0.423
ssbB/cilA	Streptococcus pneumoniae D39	42.727	99.099	0.423
ssbB/cilA	Streptococcus pneumoniae R6	42.727	99.099	0.423
ssbB/cilA	Streptococcus mitis SK321	42.727	99.099	0.423
ssbB/cilA	Streptococcus mitis NCTC 12261	41.818	99.099	0.414

Detailed information NTG0524806