Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | EFD32_RS08880 | Genome accession | NC_018221 |
| Coordinates | 1750872..1751147 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis D32 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1706507..1769253 | 1750872..1751147 | within | 0 |
Gene organization within MGE regions
Location: 1706507..1769253
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFD32_RS08555 (EFD32_1639) | - | 1706507..1707514 (-) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
| EFD32_RS08560 (EFD32_1640) | comGG | 1707643..1707996 (-) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| EFD32_RS08565 (EFD32_1641) | comGF | 1707996..1708430 (-) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| EFD32_RS08570 (EFD32_1642) | - | 1708420..1708791 (-) | 372 | WP_171803927.1 | type II secretion system protein | - |
| EFD32_RS15875 | - | 1709406..1709522 (-) | 117 | Protein_1626 | IS3 family transposase | - |
| EFD32_RS08580 (EFD32_1644) | hemH | 1709549..1710490 (-) | 942 | WP_033602825.1 | ferrochelatase | - |
| EFD32_RS08590 (EFD32_1645) | - | 1711227..1711477 (-) | 251 | Protein_1628 | hypothetical protein | - |
| EFD32_RS08595 (EFD32_1646) | - | 1711597..1712556 (+) | 960 | WP_000221326.1 | IS30-like element IS6770 family transposase | - |
| EFD32_RS08600 (EFD32_1647) | - | 1712617..1712817 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| EFD32_RS08605 (EFD32_1648) | - | 1713654..1714892 (-) | 1239 | WP_002357052.1 | LysM peptidoglycan-binding domain-containing protein | - |
| EFD32_RS08610 (EFD32_1649) | - | 1714889..1715284 (-) | 396 | WP_014862201.1 | phage holin family protein | - |
| EFD32_RS08615 (EFD32_1650) | - | 1715295..1715417 (-) | 123 | WP_002357050.1 | XkdX family protein | - |
| EFD32_RS08620 (EFD32_1651) | - | 1715417..1715791 (-) | 375 | WP_002357049.1 | hypothetical protein | - |
| EFD32_RS08625 (EFD32_1652) | - | 1715808..1716320 (-) | 513 | WP_002357048.1 | hypothetical protein | - |
| EFD32_RS08630 (EFD32_1653) | - | 1716320..1716607 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| EFD32_RS08635 (EFD32_1654) | - | 1716604..1717200 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| EFD32_RS08640 (EFD32_1655) | - | 1717193..1718074 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| EFD32_RS08645 (EFD32_1656) | - | 1718093..1720900 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| EFD32_RS08650 (EFD32_1657) | - | 1720882..1721616 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| EFD32_RS08655 (EFD32_1658) | - | 1721606..1724503 (-) | 2898 | WP_041161781.1 | tape measure protein | - |
| EFD32_RS08660 (EFD32_1659) | gpG | 1724751..1725101 (-) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| EFD32_RS08665 (EFD32_1660) | - | 1725154..1726002 (-) | 849 | WP_002385822.1 | major tail protein | - |
| EFD32_RS08670 (EFD32_1661) | - | 1726003..1726377 (-) | 375 | WP_002357037.1 | phage tail terminator family protein | - |
| EFD32_RS08675 (EFD32_1662) | - | 1726380..1726778 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| EFD32_RS08680 (EFD32_1663) | - | 1726771..1727139 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| EFD32_RS08685 (EFD32_1664) | - | 1727136..1727480 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| EFD32_RS08690 (EFD32_1665) | - | 1727494..1727676 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| EFD32_RS08695 (EFD32_1666) | - | 1727705..1728592 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| EFD32_RS08700 (EFD32_1667) | - | 1728606..1729229 (-) | 624 | WP_002389133.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| EFD32_RS08705 (EFD32_1668) | - | 1729448..1729768 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| EFD32_RS08710 | - | 1729833..1730054 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| EFD32_RS08715 (EFD32_1669) | - | 1730051..1731808 (-) | 1758 | WP_002384360.1 | head protein | - |
| EFD32_RS08720 (EFD32_1670) | - | 1731783..1733270 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| EFD32_RS08725 (EFD32_1671) | - | 1733282..1734571 (-) | 1290 | WP_002357024.1 | PBSX family phage terminase large subunit | - |
| EFD32_RS08730 (EFD32_1672) | terS | 1734543..1735346 (-) | 804 | WP_002357023.1 | phage terminase small subunit | - |
| EFD32_RS08735 (EFD32_1673) | - | 1735405..1735764 (-) | 360 | WP_002357022.1 | hypothetical protein | - |
| EFD32_RS08745 (EFD32_1675) | - | 1737354..1737770 (-) | 417 | WP_002363356.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EFD32_RS08750 (EFD32_1676) | - | 1738298..1738801 (-) | 504 | WP_010711603.1 | DUF1642 domain-containing protein | - |
| EFD32_RS08755 (EFD32_1677) | - | 1738804..1739016 (-) | 213 | WP_002368223.1 | hypothetical protein | - |
| EFD32_RS16325 (EFD32_1678) | - | 1739028..1739219 (-) | 192 | WP_010711602.1 | hypothetical protein | - |
| EFD32_RS08765 (EFD32_1679) | - | 1739261..1739446 (-) | 186 | WP_010711601.1 | hypothetical protein | - |
| EFD32_RS08770 (EFD32_1680) | - | 1739439..1740200 (-) | 762 | WP_010711600.1 | hypothetical protein | - |
| EFD32_RS08775 (EFD32_1681) | - | 1740197..1740631 (-) | 435 | WP_041161699.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EFD32_RS08780 (EFD32_1682) | - | 1740640..1740939 (-) | 300 | WP_010711597.1 | MazG-like family protein | - |
| EFD32_RS08785 (EFD32_1683) | - | 1740940..1741242 (-) | 303 | WP_002364215.1 | hypothetical protein | - |
| EFD32_RS08790 (EFD32_1684) | - | 1741246..1742208 (-) | 963 | WP_002364216.1 | Lin1244/Lin1753 domain-containing protein | - |
| EFD32_RS08795 (EFD32_1685) | - | 1742222..1743112 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| EFD32_RS08800 (EFD32_1686) | - | 1743115..1744056 (-) | 942 | WP_010817948.1 | YqaJ viral recombinase family protein | - |
| EFD32_RS08810 (EFD32_1688) | - | 1744154..1744381 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| EFD32_RS08815 (EFD32_1689) | - | 1744381..1744704 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| EFD32_RS08820 (EFD32_1690) | - | 1744748..1744933 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| EFD32_RS08825 (EFD32_1691) | - | 1744924..1745118 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| EFD32_RS08830 (EFD32_1692) | - | 1745171..1745353 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| EFD32_RS08835 (EFD32_1693) | - | 1745393..1746115 (-) | 723 | WP_002364225.1 | Rha family transcriptional regulator | - |
| EFD32_RS08840 (EFD32_1694) | - | 1746154..1746471 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| EFD32_RS08845 | - | 1746477..1746668 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| EFD32_RS08850 (EFD32_1695) | - | 1746959..1747303 (+) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| EFD32_RS08855 (EFD32_1696) | - | 1747308..1747955 (+) | 648 | WP_002356996.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EFD32_RS08860 (EFD32_1697) | - | 1748073..1748837 (+) | 765 | WP_010711480.1 | LysM peptidoglycan-binding domain-containing protein | - |
| EFD32_RS08865 (EFD32_1698) | - | 1748852..1749181 (+) | 330 | WP_002356994.1 | hypothetical protein | - |
| EFD32_RS08870 (EFD32_1699) | - | 1749256..1750404 (+) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| EFD32_RS08875 (EFD32_1700) | comGD | 1750432..1750875 (-) | 444 | WP_002369912.1 | competence type IV pilus minor pilin ComGD | - |
| EFD32_RS08880 (EFD32_1701) | comGC/cglC | 1750872..1751147 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EFD32_RS08885 (EFD32_1702) | comGB | 1751147..1752193 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| EFD32_RS08890 (EFD32_1703) | comGA | 1752150..1753118 (-) | 969 | WP_002369168.1 | competence type IV pilus ATPase ComGA | - |
| EFD32_RS08895 (EFD32_1704) | - | 1753359..1754687 (-) | 1329 | WP_002360022.1 | APC family permease | - |
| EFD32_RS08900 (EFD32_1705) | rlmN | 1754977..1756050 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| EFD32_RS08905 (EFD32_1706) | - | 1756176..1758005 (-) | 1830 | WP_002391458.1 | ABC transporter permease | - |
| EFD32_RS08910 (EFD32_1707) | - | 1757995..1758744 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| EFD32_RS08915 (EFD32_1708) | - | 1758862..1759563 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| EFD32_RS08920 (EFD32_1709) | - | 1759693..1762116 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| EFD32_RS08925 (EFD32_1711) | - | 1762430..1763641 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| EFD32_RS08930 (EFD32_1712) | - | 1763670..1764575 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| EFD32_RS08935 (EFD32_1713) | - | 1764697..1765677 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| EFD32_RS08940 (EFD32_1714) | cydC | 1765757..1767523 (-) | 1767 | WP_002369917.1 | thiol reductant ABC exporter subunit CydC | - |
| EFD32_RS08945 (EFD32_1715) | cydD | 1767520..1769253 (-) | 1734 | WP_014862205.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=52273 EFD32_RS08880 WP_002356991.1 1750872..1751147(-) (comGC/cglC) [Enterococcus faecalis D32]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=52273 EFD32_RS08880 WP_002356991.1 1750872..1751147(-) (comGC/cglC) [Enterococcus faecalis D32]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |