Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | I6H73_RS09635 | Genome accession | NZ_CP066073 |
| Coordinates | 1930803..1931171 (-) | Length | 122 a.a. |
| NCBI ID | WP_003057310.1 | Uniprot ID | - |
| Organism | Streptococcus dysgalactiae strain FDAARGOS_1016 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1905395..1941408 | 1930803..1931171 | within | 0 |
Gene organization within MGE regions
Location: 1905395..1941408
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H73_RS09460 (I6H73_09460) | - | 1905395..1906015 (-) | 621 | WP_003058266.1 | hypothetical protein | - |
| I6H73_RS09465 (I6H73_09465) | - | 1906738..1906941 (+) | 204 | WP_003055570.1 | helix-turn-helix transcriptional regulator | - |
| I6H73_RS09470 (I6H73_09470) | - | 1907025..1907777 (-) | 753 | WP_115261972.1 | CHAP domain-containing protein | - |
| I6H73_RS09475 (I6H73_09475) | - | 1907899..1908126 (-) | 228 | WP_003058873.1 | phage holin | - |
| I6H73_RS09480 (I6H73_09480) | - | 1908123..1908395 (-) | 273 | WP_003058867.1 | hypothetical protein | - |
| I6H73_RS09485 (I6H73_09485) | - | 1908407..1909018 (-) | 612 | WP_003058877.1 | hypothetical protein | - |
| I6H73_RS09490 (I6H73_09490) | - | 1909021..1909182 (-) | 162 | WP_002988795.1 | hypothetical protein | - |
| I6H73_RS09495 (I6H73_09495) | - | 1909191..1911098 (-) | 1908 | WP_003058869.1 | gp58-like family protein | - |
| I6H73_RS09500 (I6H73_09500) | - | 1911109..1911744 (-) | 636 | WP_003058871.1 | hypothetical protein | - |
| I6H73_RS09505 (I6H73_09505) | - | 1911744..1912850 (-) | 1107 | WP_003058879.1 | hypothetical protein | - |
| I6H73_RS09510 (I6H73_09510) | - | 1912847..1914901 (-) | 2055 | WP_115261973.1 | phage tail spike protein | - |
| I6H73_RS09515 (I6H73_09515) | - | 1914898..1915608 (-) | 711 | WP_037587950.1 | phage tail domain-containing protein | - |
| I6H73_RS09520 (I6H73_09520) | - | 1915605..1919006 (-) | 3402 | WP_003057308.1 | phage tail tape measure protein | - |
| I6H73_RS09525 (I6H73_09525) | - | 1919080..1919238 (-) | 159 | WP_002986162.1 | hypothetical protein | - |
| I6H73_RS09530 (I6H73_09530) | - | 1919274..1919645 (-) | 372 | WP_002986164.1 | hypothetical protein | - |
| I6H73_RS09535 (I6H73_09535) | - | 1919666..1920253 (-) | 588 | WP_003057267.1 | hypothetical protein | - |
| I6H73_RS09540 (I6H73_09540) | - | 1920264..1920686 (-) | 423 | WP_002986168.1 | hypothetical protein | - |
| I6H73_RS09545 (I6H73_09545) | - | 1920695..1921066 (-) | 372 | WP_002986170.1 | hypothetical protein | - |
| I6H73_RS09550 (I6H73_09550) | - | 1921038..1921415 (-) | 378 | WP_003057300.1 | hypothetical protein | - |
| I6H73_RS09555 (I6H73_09555) | - | 1921417..1921710 (-) | 294 | WP_003057269.1 | phage gp6-like head-tail connector protein | - |
| I6H73_RS09560 (I6H73_09560) | - | 1921730..1922017 (-) | 288 | WP_002986176.1 | hypothetical protein | - |
| I6H73_RS09565 (I6H73_09565) | - | 1922032..1923225 (-) | 1194 | WP_002986177.1 | phage major capsid protein | - |
| I6H73_RS09570 (I6H73_09570) | - | 1923260..1923976 (-) | 717 | WP_003057295.1 | head maturation protease, ClpP-related | - |
| I6H73_RS09575 (I6H73_09575) | - | 1923980..1925215 (-) | 1236 | WP_003057282.1 | phage portal protein | - |
| I6H73_RS09580 (I6H73_09580) | - | 1925414..1927072 (-) | 1659 | WP_002986185.1 | terminase TerL endonuclease subunit | - |
| I6H73_RS09585 (I6H73_09585) | - | 1927053..1927400 (-) | 348 | WP_002986187.1 | hypothetical protein | - |
| I6H73_RS09590 (I6H73_09590) | - | 1927522..1927842 (-) | 321 | WP_232621202.1 | HNH endonuclease | - |
| I6H73_RS09595 (I6H73_09595) | - | 1927848..1928141 (-) | 294 | WP_002986191.1 | hypothetical protein | - |
| I6H73_RS09600 (I6H73_09600) | - | 1928313..1928876 (-) | 564 | WP_032467304.1 | site-specific integrase | - |
| I6H73_RS09605 (I6H73_09605) | - | 1928971..1929390 (-) | 420 | WP_002986196.1 | DUF1492 domain-containing protein | - |
| I6H73_RS09610 (I6H73_09610) | - | 1929414..1929614 (-) | 201 | WP_003057287.1 | hypothetical protein | - |
| I6H73_RS09615 (I6H73_09615) | - | 1929721..1929900 (-) | 180 | WP_000694116.1 | hypothetical protein | - |
| I6H73_RS09620 (I6H73_09620) | - | 1929897..1930145 (-) | 249 | WP_115261974.1 | hypothetical protein | - |
| I6H73_RS09625 (I6H73_09625) | - | 1930148..1930486 (-) | 339 | WP_003057278.1 | helix-turn-helix transcriptional regulator | - |
| I6H73_RS09630 (I6H73_09630) | - | 1930483..1930764 (-) | 282 | WP_003057258.1 | hypothetical protein | - |
| I6H73_RS09635 (I6H73_09635) | ssbA | 1930803..1931171 (-) | 369 | WP_003057310.1 | single-stranded DNA-binding protein | Machinery gene |
| I6H73_RS09640 (I6H73_09640) | - | 1931168..1931389 (-) | 222 | WP_003057301.1 | hypothetical protein | - |
| I6H73_RS09645 (I6H73_09645) | - | 1931382..1931714 (-) | 333 | WP_003057265.1 | hypothetical protein | - |
| I6H73_RS11640 | - | 1931707..1931880 (-) | 174 | WP_080568646.1 | DUF3310 domain-containing protein | - |
| I6H73_RS11645 | - | 1932037..1932306 (-) | 270 | Protein_1907 | hypothetical protein | - |
| I6H73_RS09655 (I6H73_09655) | - | 1932408..1932647 (-) | 240 | WP_003057263.1 | hypothetical protein | - |
| I6H73_RS09660 (I6H73_09660) | - | 1932649..1932876 (-) | 228 | WP_003057262.1 | hypothetical protein | - |
| I6H73_RS09665 (I6H73_09665) | - | 1932889..1933563 (-) | 675 | WP_003057298.1 | DNA methyltransferase | - |
| I6H73_RS09670 (I6H73_09670) | - | 1933560..1933832 (-) | 273 | WP_003057296.1 | hypothetical protein | - |
| I6H73_RS09675 (I6H73_09675) | - | 1933829..1934005 (-) | 177 | WP_003057283.1 | hypothetical protein | - |
| I6H73_RS09680 (I6H73_09680) | - | 1934019..1934246 (-) | 228 | WP_003057271.1 | hypothetical protein | - |
| I6H73_RS09685 (I6H73_09685) | - | 1934246..1935067 (-) | 822 | WP_003057305.1 | ATP-binding protein | - |
| I6H73_RS09690 (I6H73_09690) | - | 1935068..1935829 (-) | 762 | WP_003057307.1 | conserved phage C-terminal domain-containing protein | - |
| I6H73_RS09695 (I6H73_09695) | dnaB | 1935822..1937162 (-) | 1341 | WP_003057292.1 | replicative DNA helicase | - |
| I6H73_RS09700 (I6H73_09700) | - | 1937149..1937337 (-) | 189 | WP_037587962.1 | hypothetical protein | - |
| I6H73_RS09705 (I6H73_09705) | - | 1937356..1937616 (-) | 261 | WP_115261976.1 | hypothetical protein | - |
| I6H73_RS09710 (I6H73_09710) | - | 1937656..1938024 (-) | 369 | WP_003057274.1 | hypothetical protein | - |
| I6H73_RS11725 | - | 1938021..1938155 (-) | 135 | WP_003057293.1 | hypothetical protein | - |
| I6H73_RS09715 (I6H73_09715) | - | 1938157..1938360 (-) | 204 | WP_003057260.1 | hypothetical protein | - |
| I6H73_RS09720 (I6H73_09720) | - | 1938402..1938566 (-) | 165 | WP_003057272.1 | hypothetical protein | - |
| I6H73_RS09725 (I6H73_09725) | - | 1938857..1939204 (+) | 348 | WP_003055470.1 | helix-turn-helix transcriptional regulator | - |
| I6H73_RS09730 (I6H73_09730) | - | 1939214..1939594 (+) | 381 | WP_003055482.1 | ImmA/IrrE family metallo-endopeptidase | - |
| I6H73_RS09735 (I6H73_09735) | - | 1939606..1940139 (+) | 534 | WP_003055464.1 | hypothetical protein | - |
| I6H73_RS09740 (I6H73_09740) | - | 1940266..1941408 (+) | 1143 | WP_181877634.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 122 a.a. Molecular weight: 13988.75 Da Isoelectric Point: 7.8786
>NTDB_id=517200 I6H73_RS09635 WP_003057310.1 1930803..1931171(-) (ssbA) [Streptococcus dysgalactiae strain FDAARGOS_1016]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRHFKNQDGQKEADFINCVMWRQAAENLTNWTKKGHLIAITGRIQTR
NYENQHGQRVYVTEVGAESFQILEKRDNTANTNSLADTMPDY
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRHFKNQDGQKEADFINCVMWRQAAENLTNWTKKGHLIAITGRIQTR
NYENQHGQRVYVTEVGAESFQILEKRDNTANTNSLADTMPDY
Nucleotide
Download Length: 369 bp
>NTDB_id=517200 I6H73_RS09635 WP_003057310.1 1930803..1931171(-) (ssbA) [Streptococcus dysgalactiae strain FDAARGOS_1016]
ATGATTAATAACGTTGTCTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTCATTTTAAAAATCAAGATGGGCAAAAAGAAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAAAAGGGCCATCTGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAACATGGTCAACGTGTTTACGTGACAGAAGTGGGTGCCGAAAGTTTTCAAATTTTAGAGAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATTGA
ATGATTAATAACGTTGTCTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTCATTTTAAAAATCAAGATGGGCAAAAAGAAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAAAAGGGCCATCTGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAACATGGTCAACGTGTTTACGTGACAGAAGTGGGTGCCGAAAGTTTTCAAATTTTAGAGAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
67.29 |
87.705 |
0.59 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
63.303 |
89.344 |
0.566 |
| ssbA | Streptococcus mutans UA159 |
45.902 |
100 |
0.459 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50.909 |
90.164 |
0.459 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.83 |
86.885 |
0.459 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.273 |
90.164 |
0.426 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.364 |
90.164 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
46.364 |
90.164 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
46.364 |
90.164 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
46.364 |
90.164 |
0.418 |
| ssbB/cilA | Streptococcus mitis SK321 |
46.364 |
90.164 |
0.418 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
42.735 |
95.902 |
0.41 |