Detailed information NTG0516872

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: I6H72_RS07475
• Genome accession: NZ_CP066055
• Coordinates: 1474141..1474458 (+)
• Length: 105 a.a.
• NCBI ID: WP_020998068.1
• Uniprot ID: U2XY26
• Organism: Streptococcus constellatus strain FDAARGOS_1015
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1469141..1479458

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
I6H72_RS07445 (I6H72_07445)	-	1469265..1469795 (+)	531	WP_150225828.1	FUSC family protein	-
I6H72_RS07450 (I6H72_07450)	-	1469872..1470231 (+)	360	WP_003073972.1	MerR family transcriptional regulator	-
I6H72_RS07455 (I6H72_07455)	glnA	1470270..1471616 (+)	1347	WP_025272015.1	type I glutamate--ammonia ligase	-
I6H72_RS07460 (I6H72_07460)	-	1471804..1472124 (+)	321	WP_198457773.1	DUF1033 family protein	-
I6H72_RS07465 (I6H72_07465)	comYA	1472239..1473180 (+)	942	WP_006268058.1	competence type IV pilus ATPase ComGA	Machinery gene
I6H72_RS07470 (I6H72_07470)	comYB	1473122..1474144 (+)	1023	WP_037592679.1	competence type IV pilus assembly protein ComGB	Machinery gene
I6H72_RS07475 (I6H72_07475)	comYC	1474141..1474458 (+)	318	WP_020998068.1	competence type IV pilus major pilin ComGC	Machinery gene
I6H72_RS07480 (I6H72_07480)	comYD	1474418..1474846 (+)	429	WP_020999411.1	competence type IV pilus minor pilin ComGD	Machinery gene
I6H72_RS07485 (I6H72_07485)	comGE/cglE	1474818..1475111 (+)	294	WP_003035318.1	competence type IV pilus minor pilin ComGE	Machinery gene
I6H72_RS07490 (I6H72_07490)	comGF/cglF	1475095..1475532 (+)	438	WP_198457774.1	competence type IV pilus minor pilin ComGF	Machinery gene
I6H72_RS07495 (I6H72_07495)	comGG	1475513..1475839 (+)	327	WP_018543596.1	competence type IV pilus minor pilin ComGG	-
I6H72_RS07500 (I6H72_07500)	comYH	1475924..1476877 (+)	954	WP_198457775.1	class I SAM-dependent methyltransferase	Machinery gene
I6H72_RS07505 (I6H72_07505)	-	1476924..1478123 (+)	1200	WP_198457776.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11678.82 Da
• Isoelectric Point: 10.1006

>NTDB_id=516872 I6H72_RS07475 WP_020998068.1 1474141..1474458(+) (comYC) [Streptococcus constellatus strain FDAARGOS_1015]
MKKIKNIKVKAFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVSEGT
ITDKQAVSYKAYYAKHTKEARTVAD

Nucleotide

• Length: 318 bp

>NTDB_id=516872 I6H72_RS07475 WP_020998068.1 1474141..1474458(+) (comYC) [Streptococcus constellatus strain FDAARGOS_1015]
ATGAAAAAAATTAAAAATATAAAGGTAAAAGCTTTCACTTTGGTAGAAATGTTAGTGGTGCTTCTAATCATCAGTGTTTT
GATGCTTTTGTTTGTTCCGAATTTGACCAAACAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCTGTTGTGAAGGTTG
TCGAAAGTCAGGCAGAGCTTTTTGAAGTGAATCATACTAATGAAAAAGCGACGCTTTCAAAATTAGTCAGTGAAGGAACT
ATTACAGACAAGCAAGCAGTATCATACAAGGCTTATTATGCAAAACATACAAAAGAAGCTCGCACAGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: U2XY26

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	72.381	100	0.724
comYC	Streptococcus mutans UA140	68.571	100	0.686
comYC	Streptococcus mutans UA159	68.571	100	0.686
comGC/cglC	Streptococcus mitis NCTC 12261	69.608	97.143	0.676
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC	Lactococcus lactis subsp. cremoris KW2	55.769	99.048	0.552
comYC	Streptococcus suis isolate S10	64.045	84.762	0.543