Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLNZ_RS10615 | Genome accession | NC_017949 |
| Coordinates | 2100371..2100796 (-) | Length | 141 a.a. |
| NCBI ID | WP_011835834.1 | Uniprot ID | A2RN06 |
| Organism | Lactococcus cremoris subsp. cremoris NZ9000 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2056108..2108296 | 2100371..2100796 | within | 0 |
Gene organization within MGE regions
Location: 2056108..2108296
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLNZ_RS10330 (LLNZ_10670) | macP | 2056108..2056386 (-) | 279 | WP_011676893.1 | cell wall synthase accessory phosphoprotein MacP | - |
| LLNZ_RS10335 (LLNZ_10675) | - | 2056379..2056963 (-) | 585 | WP_011835788.1 | NUDIX hydrolase | - |
| LLNZ_RS10340 (LLNZ_10680) | glmU | 2057064..2058440 (-) | 1377 | WP_011835789.1 | bifunctional UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase GlmU | - |
| LLNZ_RS10345 (LLNZ_10685) | proC | 2058661..2059452 (+) | 792 | WP_011835790.1 | pyrroline-5-carboxylate reductase | - |
| LLNZ_RS10350 (LLNZ_10690) | rpsO | 2059536..2059805 (-) | 270 | WP_010906184.1 | 30S ribosomal protein S15 | - |
| LLNZ_RS10355 (LLNZ_10695) | pknB | 2059976..2061853 (-) | 1878 | WP_011835791.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| LLNZ_RS10360 (LLNZ_10700) | - | 2061853..2062629 (-) | 777 | WP_011835792.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| LLNZ_RS10365 (LLNZ_10705) | rsmB | 2062752..2064026 (-) | 1275 | WP_011835793.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| LLNZ_RS10375 (LLNZ_10710) | - | 2065234..2066091 (-) | 858 | WP_011835794.1 | GH25 family lysozyme | - |
| LLNZ_RS10380 (LLNZ_10715) | - | 2066093..2066554 (-) | 462 | WP_011835795.1 | phage holin | - |
| LLNZ_RS10385 (LLNZ_10720) | - | 2066570..2066917 (-) | 348 | WP_011835796.1 | hypothetical protein | - |
| LLNZ_RS10390 (LLNZ_10725) | - | 2066930..2067166 (-) | 237 | WP_011835797.1 | hypothetical protein | - |
| LLNZ_RS10395 (LLNZ_10730) | - | 2067182..2072035 (-) | 4854 | WP_011835798.1 | serine/threonine protein phosphatase | - |
| LLNZ_RS13490 | - | 2072032..2072976 (-) | 945 | WP_050750512.1 | hypothetical protein | - |
| LLNZ_RS10410 | - | 2073038..2073685 (-) | 648 | WP_011835800.1 | distal tail protein Dit | - |
| LLNZ_RS10415 (LLNZ_10745) | - | 2073682..2078829 (-) | 5148 | WP_011835801.1 | phage tail tape measure protein | - |
| LLNZ_RS10420 (LLNZ_10750) | - | 2079052..2079468 (-) | 417 | WP_011835802.1 | phage tail assembly chaperone | - |
| LLNZ_RS10425 (LLNZ_10755) | - | 2079613..2080206 (-) | 594 | WP_011835803.1 | phage tail protein | - |
| LLNZ_RS10430 (LLNZ_10760) | - | 2080237..2080632 (-) | 396 | WP_011835804.1 | DUF806 family protein | - |
| LLNZ_RS10435 (LLNZ_10765) | - | 2080629..2081135 (-) | 507 | WP_011835805.1 | HK97 gp10 family phage protein | - |
| LLNZ_RS10440 (LLNZ_10770) | - | 2081137..2081487 (-) | 351 | WP_011835806.1 | phage head closure protein | - |
| LLNZ_RS10445 (LLNZ_10775) | - | 2081462..2081785 (-) | 324 | WP_011835807.1 | head-tail connector protein | - |
| LLNZ_RS10450 (LLNZ_10780) | - | 2081986..2083200 (-) | 1215 | WP_011835808.1 | phage major capsid protein | - |
| LLNZ_RS10455 (LLNZ_10785) | - | 2083212..2083916 (-) | 705 | WP_002819795.1 | head maturation protease, ClpP-related | - |
| LLNZ_RS10460 (LLNZ_10790) | - | 2083962..2085140 (-) | 1179 | WP_014735131.1 | phage portal protein | - |
| LLNZ_RS10465 (LLNZ_10795) | - | 2085137..2085346 (-) | 210 | WP_011835810.1 | DUF1056 family protein | - |
| LLNZ_RS10470 (LLNZ_10800) | - | 2085315..2086949 (-) | 1635 | WP_231097782.1 | terminase large subunit | - |
| LLNZ_RS10475 | - | 2087002..2088177 (-) | 1176 | Protein_2048 | IS256-like element IS905 family transposase | - |
| LLNZ_RS13495 (LLNZ_10815) | - | 2088271..2088546 (-) | 276 | Protein_2049 | terminase large subunit | - |
| LLNZ_RS10485 (LLNZ_10820) | - | 2088536..2088934 (-) | 399 | WP_011835812.1 | phage terminase small subunit P27 family | - |
| LLNZ_RS10490 (LLNZ_10825) | - | 2089116..2089634 (-) | 519 | WP_011835813.1 | HNH endonuclease | - |
| LLNZ_RS10495 (LLNZ_10830) | - | 2089638..2089928 (-) | 291 | WP_011835814.1 | hypothetical protein | - |
| LLNZ_RS10505 (LLNZ_10835) | - | 2090305..2090706 (-) | 402 | WP_011835815.1 | DUF722 domain-containing protein | - |
| LLNZ_RS10510 (LLNZ_10840) | - | 2090789..2090974 (-) | 186 | WP_011835816.1 | hypothetical protein | - |
| LLNZ_RS10515 (LLNZ_10845) | - | 2090971..2091279 (-) | 309 | WP_011835817.1 | hypothetical protein | - |
| LLNZ_RS10520 (LLNZ_10850) | - | 2091281..2091460 (-) | 180 | WP_014735134.1 | hypothetical protein | - |
| LLNZ_RS13965 (LLNZ_10855) | - | 2091462..2091596 (-) | 135 | WP_259285540.1 | hypothetical protein | - |
| LLNZ_RS10525 (LLNZ_10860) | istB | 2091711..2092469 (-) | 759 | WP_003331414.1 | IS21-like element IS712 family helper ATPase IstB | - |
| LLNZ_RS10530 (LLNZ_10865) | istA | 2092481..2093704 (-) | 1224 | WP_003331415.1 | IS21-like element IS712 family transposase | - |
| LLNZ_RS13660 (LLNZ_10870) | - | 2093760..2093903 (-) | 144 | WP_014735135.1 | hypothetical protein | - |
| LLNZ_RS10535 (LLNZ_10875) | - | 2094264..2094473 (+) | 210 | WP_011835819.1 | hypothetical protein | - |
| LLNZ_RS10540 (LLNZ_10880) | - | 2094522..2094722 (-) | 201 | WP_014735136.1 | DUF1660 domain-containing protein | - |
| LLNZ_RS10545 (LLNZ_10885) | - | 2094719..2094949 (-) | 231 | WP_011835820.1 | hypothetical protein | - |
| LLNZ_RS10550 (LLNZ_10890) | - | 2094968..2095306 (-) | 339 | WP_011835821.1 | DUF1140 family protein | - |
| LLNZ_RS10555 (LLNZ_10895) | dut | 2095307..2095726 (-) | 420 | WP_011835822.1 | dUTP diphosphatase | - |
| LLNZ_RS10560 (LLNZ_10900) | - | 2095723..2096280 (-) | 558 | WP_011835823.1 | DUF1642 domain-containing protein | - |
| LLNZ_RS10565 (LLNZ_10905) | - | 2096296..2096532 (-) | 237 | WP_011835824.1 | hypothetical protein | - |
| LLNZ_RS10570 (LLNZ_10910) | - | 2096513..2096707 (-) | 195 | WP_014735137.1 | hypothetical protein | - |
| LLNZ_RS10575 (LLNZ_10915) | - | 2096704..2096901 (-) | 198 | WP_011835825.1 | DUF1125 domain-containing protein | - |
| LLNZ_RS10580 (LLNZ_10920) | - | 2096902..2097168 (-) | 267 | WP_011835826.1 | hypothetical protein | - |
| LLNZ_RS10585 (LLNZ_10925) | - | 2097149..2097481 (-) | 333 | WP_011835827.1 | hypothetical protein | - |
| LLNZ_RS13970 | - | 2097496..2097780 (-) | 285 | WP_011835828.1 | hypothetical protein | - |
| LLNZ_RS13975 | - | 2097797..2098021 (-) | 225 | WP_011835829.1 | hypothetical protein | - |
| LLNZ_RS10595 (LLNZ_10940) | - | 2098128..2098367 (-) | 240 | WP_011835830.1 | DUF1031 domain-containing protein | - |
| LLNZ_RS10600 (LLNZ_10945) | - | 2098364..2098738 (-) | 375 | WP_011835831.1 | DUF1064 domain-containing protein | - |
| LLNZ_RS10605 (LLNZ_10950) | - | 2098735..2099460 (-) | 726 | WP_011835832.1 | hypothetical protein | - |
| LLNZ_RS10610 (LLNZ_10955) | - | 2099460..2100242 (-) | 783 | WP_011835833.1 | phage replisome organiser protein | - |
| LLNZ_RS10615 (LLNZ_10960) | ssb | 2100371..2100796 (-) | 426 | WP_011835834.1 | single-stranded DNA-binding protein | Machinery gene |
| LLNZ_RS10620 (LLNZ_10965) | - | 2100789..2100923 (-) | 135 | WP_011835835.1 | translation initiation factor | - |
| LLNZ_RS10630 (LLNZ_10975) | - | 2101176..2101547 (-) | 372 | WP_011835836.1 | Rad52/Rad22 family DNA repair protein | - |
| LLNZ_RS10635 (LLNZ_10980) | - | 2101556..2101951 (-) | 396 | WP_011835837.1 | hypothetical protein | - |
| LLNZ_RS10640 (LLNZ_10985) | - | 2102050..2102292 (-) | 243 | WP_011835838.1 | hypothetical protein | - |
| LLNZ_RS10645 (LLNZ_10990) | - | 2102379..2102777 (+) | 399 | WP_187287215.1 | DUF2513 domain-containing protein | - |
| LLNZ_RS10650 (LLNZ_10995) | - | 2102770..2102973 (-) | 204 | WP_011835840.1 | hypothetical protein | - |
| LLNZ_RS10655 (LLNZ_11000) | - | 2103069..2103338 (-) | 270 | WP_011835841.1 | hypothetical protein | - |
| LLNZ_RS10660 (LLNZ_11005) | - | 2103352..2104110 (-) | 759 | WP_011835842.1 | phage repressor protein/antirepressor Ant | - |
| LLNZ_RS10665 (LLNZ_11010) | - | 2104123..2104371 (-) | 249 | WP_011835843.1 | helix-turn-helix transcriptional regulator | - |
| LLNZ_RS10670 (LLNZ_11015) | - | 2104476..2104712 (+) | 237 | WP_011835844.1 | hypothetical protein | - |
| LLNZ_RS10675 (LLNZ_11020) | - | 2104684..2104905 (-) | 222 | WP_011835845.1 | hypothetical protein | - |
| LLNZ_RS10680 (LLNZ_11030) | - | 2105280..2105477 (-) | 198 | WP_014735140.1 | hypothetical protein | - |
| LLNZ_RS10685 (LLNZ_11035) | - | 2105728..2106258 (+) | 531 | WP_374930652.1 | helix-turn-helix domain-containing protein | - |
| LLNZ_RS10690 (LLNZ_11040) | - | 2106264..2106698 (+) | 435 | WP_011835848.1 | zinc peptidase | - |
| LLNZ_RS10695 (LLNZ_11045) | - | 2106712..2107047 (+) | 336 | WP_011835849.1 | hypothetical protein | - |
| LLNZ_RS10700 (LLNZ_11050) | - | 2107115..2108296 (+) | 1182 | WP_014735141.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15685.50 Da Isoelectric Point: 6.9813
>NTDB_id=51426 LLNZ_RS10615 WP_011835834.1 2100371..2100796(-) (ssb) [Lactococcus cremoris subsp. cremoris NZ9000]
MINNVTLVGRITKKPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKKPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=51426 LLNZ_RS10615 WP_011835834.1 2100371..2100796(-) (ssb) [Lactococcus cremoris subsp. cremoris NZ9000]
ATGATTAACAATGTCACTCTAGTAGGGCGAATCACTAAAAAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATACAGACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATCACTAAAAAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATACAGACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.529 |
100 |
0.645 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.731 |
73.759 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
51.456 |
73.05 |
0.376 |