Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | I8F59_RS09250 | Genome accession | NZ_CP065784 |
| Coordinates | 1850879..1851154 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 18-243 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1811462..1871692 | 1850879..1851154 | within | 0 |
Gene organization within MGE regions
Location: 1811462..1871692
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I8F59_RS08985 (I8F59_08985) | - | 1811462..1812469 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| I8F59_RS08990 (I8F59_08990) | comGG | 1812598..1812951 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| I8F59_RS08995 (I8F59_08995) | comGF | 1812951..1813385 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| I8F59_RS09000 (I8F59_09000) | - | 1813375..1813701 (-) | 327 | WP_010775953.1 | type II secretion system protein | - |
| I8F59_RS09005 (I8F59_09005) | hemH | 1814503..1815444 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| I8F59_RS09015 (I8F59_09015) | - | 1816160..1816432 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| I8F59_RS09020 (I8F59_09020) | - | 1816504..1816704 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| I8F59_RS09025 (I8F59_09025) | - | 1817557..1818816 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| I8F59_RS09030 (I8F59_09030) | - | 1818829..1819209 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| I8F59_RS09035 (I8F59_09035) | - | 1819220..1819342 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| I8F59_RS09040 (I8F59_09040) | - | 1819344..1819739 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| I8F59_RS09045 (I8F59_09045) | - | 1819758..1820210 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| I8F59_RS09050 (I8F59_09050) | - | 1820227..1820967 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| I8F59_RS09055 (I8F59_09055) | - | 1820973..1822418 (-) | 1446 | WP_010712603.1 | phage tail spike protein | - |
| I8F59_RS09060 (I8F59_09060) | - | 1822418..1823140 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| I8F59_RS09065 (I8F59_09065) | - | 1823137..1827591 (-) | 4455 | WP_142665569.1 | phage tail tape measure protein | - |
| I8F59_RS09070 (I8F59_09070) | - | 1827578..1827883 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| I8F59_RS09075 (I8F59_09075) | - | 1827952..1828350 (-) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| I8F59_RS09080 (I8F59_09080) | - | 1828413..1828721 (-) | 309 | WP_010785047.1 | hypothetical protein | - |
| I8F59_RS09085 (I8F59_09085) | - | 1828724..1829329 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| I8F59_RS09090 (I8F59_09090) | - | 1829348..1829740 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| I8F59_RS09095 (I8F59_09095) | - | 1829737..1830075 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| I8F59_RS09100 (I8F59_09100) | - | 1830072..1830347 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| I8F59_RS09105 (I8F59_09105) | - | 1830344..1830676 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| I8F59_RS09110 (I8F59_09110) | - | 1830747..1831643 (-) | 897 | WP_002363368.1 | hypothetical protein | - |
| I8F59_RS09115 (I8F59_09115) | - | 1831657..1832292 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| I8F59_RS09120 (I8F59_09120) | - | 1832415..1833341 (-) | 927 | WP_033593778.1 | minor capsid protein | - |
| I8F59_RS09125 (I8F59_09125) | - | 1833334..1834818 (-) | 1485 | WP_002388192.1 | phage portal protein | - |
| I8F59_RS09130 (I8F59_09130) | - | 1834818..1836101 (-) | 1284 | WP_142665572.1 | PBSX family phage terminase large subunit | - |
| I8F59_RS09135 (I8F59_09135) | - | 1836082..1836516 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| I8F59_RS15420 | - | 1836548..1836778 (-) | 231 | Protein_1783 | hypothetical protein | - |
| I8F59_RS09140 (I8F59_09140) | - | 1837399..1838079 (-) | 681 | WP_010820923.1 | hypothetical protein | - |
| I8F59_RS09145 (I8F59_09145) | - | 1838093..1839031 (-) | 939 | WP_010820924.1 | hypothetical protein | - |
| I8F59_RS09155 (I8F59_09155) | - | 1839740..1840156 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| I8F59_RS09160 (I8F59_09160) | - | 1841065..1841473 (-) | 409 | Protein_1787 | RusA family crossover junction endodeoxyribonuclease | - |
| I8F59_RS09165 (I8F59_09165) | - | 1841470..1842327 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| I8F59_RS09170 (I8F59_09170) | - | 1842327..1842527 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| I8F59_RS09175 (I8F59_09175) | - | 1842532..1843173 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| I8F59_RS09180 (I8F59_09180) | - | 1843178..1843912 (-) | 735 | WP_002378463.1 | ERF family protein | - |
| I8F59_RS09185 (I8F59_09185) | - | 1843905..1844222 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| I8F59_RS09190 (I8F59_09190) | - | 1844442..1844996 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| I8F59_RS15425 | - | 1845423..1845617 (-) | 195 | WP_244323659.1 | hypothetical protein | - |
| I8F59_RS09200 (I8F59_09200) | - | 1845654..1845863 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| I8F59_RS09205 (I8F59_09205) | - | 1845918..1846106 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| I8F59_RS09210 (I8F59_09210) | - | 1846132..1846857 (-) | 726 | WP_002378466.1 | phage regulatory protein | - |
| I8F59_RS09215 (I8F59_09215) | - | 1846896..1847207 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| I8F59_RS09220 (I8F59_09220) | - | 1847218..1847394 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| I8F59_RS09225 (I8F59_09225) | - | 1847706..1848038 (+) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| I8F59_RS09230 (I8F59_09230) | - | 1848055..1848399 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| I8F59_RS09235 (I8F59_09235) | - | 1848435..1849163 (+) | 729 | WP_002378468.1 | ion transporter | - |
| I8F59_RS09240 (I8F59_09240) | - | 1849263..1850411 (+) | 1149 | WP_002378469.1 | site-specific integrase | - |
| I8F59_RS09245 (I8F59_09245) | comGD | 1850448..1850882 (-) | 435 | Protein_1804 | competence type IV pilus minor pilin ComGD | - |
| I8F59_RS09250 (I8F59_09250) | comGC/cglC | 1850879..1851154 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| I8F59_RS09255 (I8F59_09255) | comGB | 1851154..1852200 (-) | 1047 | WP_002401325.1 | competence type IV pilus assembly protein ComGB | - |
| I8F59_RS09260 (I8F59_09260) | comGA | 1852157..1853125 (-) | 969 | WP_002401324.1 | competence type IV pilus ATPase ComGA | - |
| I8F59_RS09265 (I8F59_09265) | - | 1853365..1854693 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| I8F59_RS09270 (I8F59_09270) | rlmN | 1854983..1856056 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| I8F59_RS09275 (I8F59_09275) | - | 1856181..1858010 (-) | 1830 | WP_002391458.1 | ABC transporter permease | - |
| I8F59_RS09280 (I8F59_09280) | - | 1858000..1858749 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| I8F59_RS09285 (I8F59_09285) | - | 1858867..1859568 (-) | 702 | WP_002356983.1 | GntR family transcriptional regulator | - |
| I8F59_RS09290 (I8F59_09290) | - | 1859699..1862122 (-) | 2424 | WP_002411391.1 | DNA translocase FtsK | - |
| I8F59_RS09295 (I8F59_09295) | - | 1862436..1863647 (-) | 1212 | WP_142954355.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| I8F59_RS09300 (I8F59_09300) | - | 1863676..1864581 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| I8F59_RS09305 (I8F59_09305) | - | 1864703..1865683 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| I8F59_RS09310 (I8F59_09310) | cydC | 1865763..1867529 (-) | 1767 | WP_002411395.1 | thiol reductant ABC exporter subunit CydC | - |
| I8F59_RS09315 (I8F59_09315) | cydD | 1867526..1869259 (-) | 1734 | WP_002364369.1 | thiol reductant ABC exporter subunit CydD | - |
| I8F59_RS09320 (I8F59_09320) | cydB | 1869264..1870277 (-) | 1014 | WP_002356976.1 | cytochrome d ubiquinol oxidase subunit II | - |
| I8F59_RS09325 (I8F59_09325) | - | 1870274..1871692 (-) | 1419 | WP_002356974.1 | cytochrome ubiquinol oxidase subunit I | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=514220 I8F59_RS09250 WP_002356991.1 1850879..1851154(-) (comGC/cglC) [Enterococcus faecalis strain 18-243]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=514220 I8F59_RS09250 WP_002356991.1 1850879..1851154(-) (comGC/cglC) [Enterococcus faecalis strain 18-243]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |