Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | IUJ47_RS12655 | Genome accession | NZ_CP064374 |
| Coordinates | 2568673..2568948 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain PartL-Efaecalis-RM8376 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2525629..2568649 | 2568673..2568948 | flank | 24 |
Gene organization within MGE regions
Location: 2525629..2568948
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| IUJ47_RS12355 (IUJ47_12325) | - | 2525629..2526636 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| IUJ47_RS12360 (IUJ47_12330) | comGG | 2526765..2527118 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| IUJ47_RS12365 (IUJ47_12335) | comGF | 2527118..2527552 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| IUJ47_RS12370 (IUJ47_12340) | - | 2527542..2527868 (-) | 327 | WP_010775953.1 | type II secretion system protein | - |
| IUJ47_RS12375 (IUJ47_12345) | hemH | 2528670..2529611 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| IUJ47_RS12385 (IUJ47_12355) | - | 2530327..2530599 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| IUJ47_RS12390 (IUJ47_12360) | - | 2530671..2530871 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| IUJ47_RS12395 (IUJ47_12365) | - | 2531708..2532949 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| IUJ47_RS12400 (IUJ47_12370) | - | 2532950..2533183 (-) | 234 | WP_002384371.1 | phage holin | - |
| IUJ47_RS12405 (IUJ47_12375) | - | 2533176..2533397 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| IUJ47_RS12410 (IUJ47_12380) | - | 2533432..2533587 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| IUJ47_RS12415 (IUJ47_12385) | - | 2533589..2533909 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| IUJ47_RS12420 (IUJ47_12390) | - | 2533923..2534414 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| IUJ47_RS12425 (IUJ47_12395) | - | 2534414..2534701 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| IUJ47_RS12430 (IUJ47_12400) | - | 2534698..2535294 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| IUJ47_RS12435 (IUJ47_12405) | - | 2535287..2536168 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| IUJ47_RS12440 (IUJ47_12410) | - | 2536187..2538994 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| IUJ47_RS12445 (IUJ47_12415) | - | 2538976..2539710 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| IUJ47_RS12450 (IUJ47_12420) | - | 2539700..2542597 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| IUJ47_RS12455 (IUJ47_12425) | gpG | 2542845..2543195 (-) | 351 | WP_002370959.1 | phage tail assembly chaperone G | - |
| IUJ47_RS12460 (IUJ47_12430) | - | 2543248..2544096 (-) | 849 | WP_002384363.1 | major tail protein | - |
| IUJ47_RS12465 (IUJ47_12435) | - | 2544097..2544471 (-) | 375 | WP_002357037.1 | phage tail terminator family protein | - |
| IUJ47_RS12470 (IUJ47_12440) | - | 2544474..2544872 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| IUJ47_RS12475 (IUJ47_12445) | - | 2544865..2545233 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| IUJ47_RS12480 (IUJ47_12450) | - | 2545230..2545574 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| IUJ47_RS12485 (IUJ47_12455) | - | 2545588..2545770 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| IUJ47_RS12490 (IUJ47_12460) | - | 2545799..2546686 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| IUJ47_RS12495 (IUJ47_12465) | - | 2546700..2547323 (-) | 624 | WP_002389133.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| IUJ47_RS12500 (IUJ47_12470) | - | 2547541..2547861 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| IUJ47_RS12505 (IUJ47_12475) | - | 2547926..2548147 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| IUJ47_RS12510 (IUJ47_12480) | - | 2548144..2549901 (-) | 1758 | WP_002384360.1 | head protein | - |
| IUJ47_RS12515 (IUJ47_12485) | - | 2549876..2551363 (-) | 1488 | WP_002384358.1 | phage portal protein | - |
| IUJ47_RS12520 (IUJ47_12490) | - | 2551375..2552664 (-) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| IUJ47_RS12525 (IUJ47_12495) | terS | 2552636..2553439 (-) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| IUJ47_RS12530 (IUJ47_12500) | - | 2553708..2554625 (+) | 918 | WP_002370955.1 | beta family protein | - |
| IUJ47_RS12535 (IUJ47_12505) | - | 2554663..2555241 (-) | 579 | WP_002370953.1 | sce7726 family protein | - |
| IUJ47_RS12540 (IUJ47_12510) | - | 2555385..2555618 (-) | 234 | WP_002389079.1 | hypothetical protein | - |
| IUJ47_RS12550 (IUJ47_12520) | - | 2556612..2557028 (-) | 417 | WP_010816133.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| IUJ47_RS12555 (IUJ47_12525) | - | 2557935..2558360 (-) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| IUJ47_RS12560 (IUJ47_12530) | - | 2558378..2558677 (-) | 300 | WP_002389080.1 | MazG-like family protein | - |
| IUJ47_RS12565 (IUJ47_12535) | - | 2558678..2558980 (-) | 303 | WP_002389299.1 | hypothetical protein | - |
| IUJ47_RS12570 (IUJ47_12540) | - | 2558984..2559985 (-) | 1002 | WP_002389256.1 | Lin1244/Lin1753 domain-containing protein | - |
| IUJ47_RS12575 (IUJ47_12545) | - | 2560022..2560915 (-) | 894 | WP_002369907.1 | recombinase RecT | - |
| IUJ47_RS12580 (IUJ47_12550) | - | 2560915..2561859 (-) | 945 | WP_002389314.1 | YqaJ viral recombinase family protein | - |
| IUJ47_RS12585 (IUJ47_12555) | - | 2561957..2562184 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| IUJ47_RS12590 (IUJ47_12560) | - | 2562184..2562507 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| IUJ47_RS12595 (IUJ47_12565) | - | 2562551..2562736 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| IUJ47_RS12600 (IUJ47_12570) | - | 2562727..2562921 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| IUJ47_RS12605 (IUJ47_12575) | - | 2562974..2563156 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| IUJ47_RS12610 (IUJ47_12580) | - | 2563196..2563917 (-) | 722 | Protein_2452 | Rha family transcriptional regulator | - |
| IUJ47_RS12615 (IUJ47_12585) | - | 2563956..2564273 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| IUJ47_RS12620 (IUJ47_12590) | - | 2564279..2564470 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| IUJ47_RS12625 (IUJ47_12595) | - | 2564761..2565105 (+) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| IUJ47_RS12630 (IUJ47_12600) | - | 2565118..2565756 (+) | 639 | WP_002389292.1 | ImmA/IrrE family metallo-endopeptidase | - |
| IUJ47_RS12635 (IUJ47_12605) | - | 2565874..2566638 (+) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| IUJ47_RS12640 (IUJ47_12610) | - | 2566653..2566982 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| IUJ47_RS12645 (IUJ47_12615) | - | 2567057..2568205 (+) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| IUJ47_RS12650 (IUJ47_12620) | comGD | 2568233..2568676 (-) | 444 | WP_025189135.1 | competence type IV pilus minor pilin ComGD | - |
| IUJ47_RS12655 (IUJ47_12625) | comGC/cglC | 2568673..2568948 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=501293 IUJ47_RS12655 WP_002356991.1 2568673..2568948(-) (comGC/cglC) [Enterococcus faecalis strain PartL-Efaecalis-RM8376]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=501293 IUJ47_RS12655 WP_002356991.1 2568673..2568948(-) (comGC/cglC) [Enterococcus faecalis strain PartL-Efaecalis-RM8376]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |