Detailed information NTG0498235

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: IP614_RS17300
• Genome accession: NZ_CP063975
• Coordinates: 3353643..3353978 (+)
• Length: 111 a.a.
• NCBI ID: WP_000982014.1
• Uniprot ID: A0A9W5QVD6
• Organism: Bacillus cereus strain N435-1
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	3354184..3355617	3353643..3353978	flank	206

Gene organization within MGE regions

Location: 3353643..3355617

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IP614_RS17300	ssbA	3353643..3353978 (+)	336	WP_000982014.1	single-stranded DNA-binding protein	Machinery gene
IP614_RS17305	-	3354184..3355617 (-)	1434	WP_221826776.1	IS4-like element IS231Q family transposase	-

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12741.59 Da
• Isoelectric Point: 9.4344

>NTDB_id=498235 IP614_RS17300 WP_000982014.1 3353643..3353978(+) (ssbA) [Bacillus cereus strain N435-1]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 336 bp

>NTDB_id=498235 IP614_RS17300 WP_000982014.1 3353643..3353978(+) (ssbA) [Bacillus cereus strain N435-1]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTAAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAGCTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.434	95.495	0.568
ssb	Latilactobacillus sakei subsp. sakei 23K	56.604	95.495	0.541
ssbB	Bacillus subtilis subsp. subtilis str. 168	51.786	100	0.523
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	94.595	0.432
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.636	99.099	0.432
ssbA	Streptococcus mutans UA159	40.909	99.099	0.405
ssbB/cilA	Streptococcus mitis NCTC 12261	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae TIGR4	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae D39	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae R6	40	99.099	0.396
ssbB/cilA	Streptococcus mitis SK321	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae Rx1	40	99.099	0.396