Detailed information NTG0049820

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SSUA7_RS00795
• Genome accession: NC_017622
• Coordinates: 121918..122199 (+)
• Length: 93 a.a.
• NCBI ID: WP_011921720.1
• Uniprot ID: A0A0M9FL05
• Organism: Streptococcus suis A7
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 116918..127199

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SSUA7_RS00775 (SSUA7_0120)	-	118588..118953 (+)	366	WP_002936568.1	DUF1033 family protein	-
SSUA7_RS00780 (SSUA7_0121)	-	118988..119931 (-)	944	Protein_115	S66 peptidase family protein	-
SSUA7_RS00785 (SSUA7_0122)	comYA	120017..120967 (+)	951	WP_011921718.1	competence type IV pilus ATPase ComGA	Machinery gene
SSUA7_RS00790 (SSUA7_0123)	comYB	120879..121916 (+)	1038	WP_011921719.1	competence type IV pilus assembly protein ComGB	Machinery gene
SSUA7_RS00795 (SSUA7_0124)	comYC	121918..122199 (+)	282	WP_011921720.1	competence type IV pilus major pilin ComGC	Machinery gene
SSUA7_RS00800 (SSUA7_0125)	comGD	122180..122587 (+)	408	WP_011921721.1	competence type IV pilus minor pilin ComGD	-
SSUA7_RS00805 (SSUA7_0126)	comYE	122559..122852 (+)	294	WP_011921722.1	competence type IV pilus minor pilin ComGE	Machinery gene
SSUA7_RS00810 (SSUA7_0127)	comGF/cglF	122839..123273 (+)	435	WP_011922561.1	competence type IV pilus minor pilin ComGF	Machinery gene
SSUA7_RS00815 (SSUA7_0128)	comGG	123251..123661 (+)	411	WP_011921724.1	competence type IV pilus minor pilin ComGG	-
SSUA7_RS00820 (SSUA7_0129)	comYH	123718..124671 (+)	954	WP_011922562.1	class I SAM-dependent methyltransferase	Machinery gene
SSUA7_RS00825 (SSUA7_0130)	-	124721..125908 (+)	1188	WP_012775422.1	acetate kinase	-
SSUA7_RS00830 (SSUA7_0132)	-	126223..126774 (+)	552	WP_012774908.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10408.34 Da
• Isoelectric Point: 7.0117

>NTDB_id=49820 SSUA7_RS00795 WP_011921720.1 121918..122199(+) (comYC) [Streptococcus suis A7]
MKKLVEMKVKGFTLVEMLVVLGIISLLLLLFVPNLSQQKDAIQKKGDAAVVKVVESQMELYELEHDEEATVADLQAKGYI
TEKQAKQYATAKK

Nucleotide

• Length: 282 bp

>NTDB_id=49820 SSUA7_RS00795 WP_011921720.1 121918..122199(+) (comYC) [Streptococcus suis A7]
ATGAAAAAATTAGTTGAAATGAAGGTAAAAGGGTTCACTCTGGTGGAAATGTTGGTCGTTTTAGGGATCATTAGCCTGCT
CTTGCTCCTCTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGGATGCGGCTGTTGTCAAAGTAG
TGGAGAGTCAGATGGAGCTCTATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGATTTGCAGGCGAAAGGTTATATT
ACTGAAAAACAAGCAAAACAGTATGCTACGGCGAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0M9FL05

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	100	100	1
comGC/cglC	Streptococcus mitis SK321	68.235	91.398	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	68.235	91.398	0.624
comGC/cglC	Streptococcus pneumoniae D39	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae R6	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae TIGR4	70.37	87.097	0.613
comGC/cglC	Streptococcus pneumoniae Rx1	70.37	87.097	0.613
comYC	Streptococcus gordonii str. Challis substr. CH1	61.798	95.699	0.591
comYC	Streptococcus mutans UA140	60.227	94.624	0.57
comYC	Streptococcus mutans UA159	60.227	94.624	0.57
comGC	Lactococcus lactis subsp. cremoris KW2	56.818	94.624	0.538
comGC	Staphylococcus aureus N315	50	83.871	0.419
comGC	Staphylococcus aureus MW2	50	83.871	0.419
comGC	Bacillus subtilis subsp. subtilis str. 168	49.333	80.645	0.398
comGC	Latilactobacillus sakei subsp. sakei 23K	43.75	86.022	0.376