Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | HW271_RS07635 | Genome accession | NZ_CP058258 |
| Coordinates | 1557659..1557982 (-) | Length | 107 a.a. |
| NCBI ID | WP_178895506.1 | Uniprot ID | A0A7H8ZAW9 |
| Organism | Streptococcus sp. oral taxon 061 strain F0704 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1556573..1571199 | 1557659..1557982 | within | 0 |
Gene organization within MGE regions
Location: 1556573..1571199
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HW271_RS07620 (HW271_07620) | comGF/cglF | 1556573..1557034 (-) | 462 | WP_178895504.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| HW271_RS07625 (HW271_07625) | comGE/cglE | 1556997..1557299 (-) | 303 | WP_178895505.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| HW271_RS07630 (HW271_07630) | comGD/cglD | 1557262..1557696 (-) | 435 | WP_254730736.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| HW271_RS07635 (HW271_07635) | comGC/cglC | 1557659..1557982 (-) | 324 | WP_178895506.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| HW271_RS07640 (HW271_07640) | comGB/cglB | 1557983..1558999 (-) | 1017 | WP_178895665.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| HW271_RS07645 (HW271_07645) | comGA/cglA/cilD | 1558947..1559888 (-) | 942 | WP_178895507.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| HW271_RS07650 (HW271_07650) | - | 1559941..1560318 (-) | 378 | WP_178895508.1 | DUF1033 family protein | - |
| HW271_RS07655 (HW271_07655) | nagA | 1560485..1561636 (-) | 1152 | WP_178895509.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| HW271_RS07660 (HW271_07660) | - | 1562219..1562842 (-) | 624 | WP_178895510.1 | hypothetical protein | - |
| HW271_RS07665 (HW271_07665) | - | 1562928..1565552 (-) | 2625 | WP_178895511.1 | SEC10/PgrA surface exclusion domain-containing protein | - |
| HW271_RS07670 (HW271_07670) | - | 1565704..1566033 (+) | 330 | WP_049478720.1 | helix-turn-helix domain-containing protein | - |
| HW271_RS07675 (HW271_07675) | - | 1566125..1566958 (-) | 834 | WP_178895512.1 | hypothetical protein | - |
| HW271_RS07680 (HW271_07680) | - | 1567125..1567481 (+) | 357 | WP_178895513.1 | hypothetical protein | - |
| HW271_RS07685 (HW271_07685) | - | 1567485..1568645 (+) | 1161 | WP_178895514.1 | cell division protein FtsK | - |
| HW271_RS07690 (HW271_07690) | - | 1568840..1569259 (+) | 420 | WP_259274708.1 | hypothetical protein | - |
| HW271_RS07695 (HW271_07695) | - | 1569469..1570797 (+) | 1329 | WP_178895515.1 | Rep family protein | - |
| HW271_RS07700 (HW271_07700) | - | 1570861..1571199 (+) | 339 | WP_049478726.1 | DUF771 domain-containing protein | - |
Sequence
Protein
Download Length: 107 a.a. Molecular weight: 11940.08 Da Isoelectric Point: 10.0759
>NTDB_id=463251 HW271_RS07635 WP_178895506.1 1557659..1557982(-) (comGC/cglC) [Streptococcus sp. oral taxon 061 strain F0704]
MKKMLMKFKKAQVKAFTLVEMLVVLLIISVLLLLFVPNLTKQKDAVNDKGKAAVVKVVESQAELYSLDKNEDASLSKLQA
DGRITAEQAKAYKEYHAKQNTNQTVAD
MKKMLMKFKKAQVKAFTLVEMLVVLLIISVLLLLFVPNLTKQKDAVNDKGKAAVVKVVESQAELYSLDKNEDASLSKLQA
DGRITAEQAKAYKEYHAKQNTNQTVAD
Nucleotide
Download Length: 324 bp
>NTDB_id=463251 HW271_RS07635 WP_178895506.1 1557659..1557982(-) (comGC/cglC) [Streptococcus sp. oral taxon 061 strain F0704]
ATGAAAAAAATGTTGATGAAATTTAAAAAAGCTCAGGTTAAAGCTTTCACACTAGTCGAAATGTTGGTGGTGTTGCTTAT
CATTAGTGTCCTACTCTTACTGTTTGTGCCAAACCTAACTAAGCAAAAGGATGCAGTGAATGACAAGGGGAAAGCAGCTG
TCGTCAAGGTGGTAGAAAGCCAGGCAGAACTCTATAGTCTGGATAAAAATGAAGATGCCAGTCTAAGCAAATTACAGGCA
GATGGACGTATCACTGCTGAGCAGGCAAAAGCCTACAAAGAATACCATGCAAAACAAAATACAAATCAAACAGTTGCGGA
TTAA
ATGAAAAAAATGTTGATGAAATTTAAAAAAGCTCAGGTTAAAGCTTTCACACTAGTCGAAATGTTGGTGGTGTTGCTTAT
CATTAGTGTCCTACTCTTACTGTTTGTGCCAAACCTAACTAAGCAAAAGGATGCAGTGAATGACAAGGGGAAAGCAGCTG
TCGTCAAGGTGGTAGAAAGCCAGGCAGAACTCTATAGTCTGGATAAAAATGAAGATGCCAGTCTAAGCAAATTACAGGCA
GATGGACGTATCACTGCTGAGCAGGCAAAAGCCTACAAAGAATACCATGCAAAACAAAATACAAATCAAACAGTTGCGGA
TTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus mitis NCTC 12261 |
92.523 |
100 |
0.925 |
| comGC/cglC | Streptococcus mitis SK321 |
85.185 |
100 |
0.86 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
83.333 |
100 |
0.841 |
| comGC/cglC | Streptococcus pneumoniae D39 |
83.333 |
100 |
0.841 |
| comGC/cglC | Streptococcus pneumoniae R6 |
83.333 |
100 |
0.841 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
82.407 |
100 |
0.832 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
68.932 |
96.262 |
0.664 |
| comYC | Streptococcus mutans UA140 |
69.474 |
88.785 |
0.617 |
| comYC | Streptococcus mutans UA159 |
69.474 |
88.785 |
0.617 |
| comYC | Streptococcus suis isolate S10 |
69.136 |
75.701 |
0.523 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
59.341 |
85.047 |
0.505 |
| comGC | Staphylococcus aureus MW2 |
49.383 |
75.701 |
0.374 |
| comGC | Staphylococcus aureus N315 |
49.383 |
75.701 |
0.374 |