Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | EF62_RS12350 | Genome accession | NC_017312 |
| Coordinates | 2365801..2366031 (-) | Length | 76 a.a. |
| NCBI ID | WP_010818911.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis 62 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2322495..2367077 | 2365801..2366031 | within | 0 |
Gene organization within MGE regions
Location: 2322495..2367077
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EF62_RS12025 (EF62_2344) | - | 2322495..2323502 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| EF62_RS12030 (EF62_2345) | comGG | 2323631..2323984 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| EF62_RS12035 (EF62_2346) | comGF | 2323984..2324418 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| EF62_RS12040 (EF62_2347) | - | 2324408..2324734 (-) | 327 | WP_002393943.1 | type II secretion system protein | - |
| EF62_RS12050 (EF62_2349) | hemH | 2325536..2326477 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| EF62_RS12060 (EF62_2352) | - | 2327221..2327472 (-) | 252 | WP_002364188.1 | hypothetical protein | - |
| EF62_RS12065 (EF62_2353) | - | 2327544..2327744 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| EF62_RS12070 (EF62_2354) | - | 2328581..2329822 (-) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| EF62_RS12075 (EF62_2355) | - | 2329823..2330056 (-) | 234 | WP_002384371.1 | phage holin | - |
| EF62_RS12080 (EF62_2356) | - | 2330049..2330270 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| EF62_RS12085 (EF62_2357) | - | 2330305..2330460 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| EF62_RS12090 (EF62_2358) | - | 2330462..2330782 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| EF62_RS12095 (EF62_2359) | - | 2330796..2331287 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| EF62_RS12100 (EF62_2360) | - | 2331287..2331538 (-) | 252 | WP_014524854.1 | hypothetical protein | - |
| EF62_RS12105 (EF62_2361) | - | 2331535..2332131 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| EF62_RS12110 (EF62_2362) | - | 2332124..2333005 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| EF62_RS12115 (EF62_2363) | - | 2333024..2335831 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| EF62_RS12120 (EF62_2364) | - | 2335813..2336547 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| EF62_RS12125 (EF62_2365) | - | 2336537..2339434 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| EF62_RS12130 (EF62_2366) | - | 2339682..2340032 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| EF62_RS12135 (EF62_2367) | - | 2340085..2340933 (-) | 849 | WP_002384363.1 | major tail protein | - |
| EF62_RS12140 (EF62_2368) | - | 2340934..2341308 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| EF62_RS12145 (EF62_2369) | - | 2341311..2341709 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| EF62_RS12150 (EF62_2370) | - | 2341702..2342070 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| EF62_RS12155 (EF62_2371) | - | 2342067..2342411 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| EF62_RS12160 (EF62_2372) | - | 2342425..2342607 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| EF62_RS12165 (EF62_2373) | - | 2342636..2343523 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| EF62_RS12170 (EF62_2374) | - | 2343537..2344160 (-) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| EF62_RS12175 (EF62_2375) | - | 2344379..2344699 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| EF62_RS12180 (EF62_2376) | - | 2344756..2344986 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| EF62_RS12185 (EF62_2377) | - | 2344987..2346891 (-) | 1905 | WP_002393613.1 | hypothetical protein | - |
| EF62_RS12190 (EF62_2378) | - | 2346866..2348353 (-) | 1488 | WP_014524856.1 | phage portal protein | - |
| EF62_RS12195 (EF62_2379) | - | 2348365..2349654 (-) | 1290 | WP_045009085.1 | PBSX family phage terminase large subunit | - |
| EF62_RS12200 (EF62_2380) | terS | 2349626..2350429 (-) | 804 | WP_010823780.1 | phage terminase small subunit | - |
| EF62_RS12205 (EF62_2381) | - | 2350488..2350847 (-) | 360 | WP_010823781.1 | hypothetical protein | - |
| EF62_RS12210 (EF62_2382) | - | 2351425..2352024 (-) | 600 | WP_014524858.1 | hypothetical protein | - |
| EF62_RS12215 (EF62_2383) | - | 2352037..2352561 (-) | 525 | WP_014524859.1 | hypothetical protein | - |
| EF62_RS12220 (EF62_2384) | - | 2352591..2353043 (-) | 453 | WP_014524860.1 | hypothetical protein | - |
| EF62_RS12230 (EF62_2386) | - | 2353758..2354174 (-) | 417 | WP_010823784.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EF62_RS12240 (EF62_2387) | - | 2355081..2355515 (-) | 435 | WP_002372046.1 | RusA family crossover junction endodeoxyribonuclease | - |
| EF62_RS12245 (EF62_2388) | - | 2355524..2355823 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| EF62_RS12250 (EF62_2389) | - | 2355824..2356126 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| EF62_RS12255 (EF62_2390) | - | 2356130..2357092 (-) | 963 | WP_002372048.1 | Lin1244/Lin1753 domain-containing protein | - |
| EF62_RS12260 (EF62_2391) | - | 2357106..2357996 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| EF62_RS12265 (EF62_2392) | - | 2357999..2358940 (-) | 942 | WP_002364219.1 | lambda-exonuclease family protein | - |
| EF62_RS12275 (EF62_2394) | - | 2359038..2359265 (-) | 228 | WP_010823786.1 | hypothetical protein | - |
| EF62_RS12280 (EF62_2395) | - | 2359265..2359588 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| EF62_RS12285 (EF62_2396) | - | 2359632..2359817 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| EF62_RS12290 (EF62_2397) | - | 2359808..2360002 (-) | 195 | WP_014524862.1 | hypothetical protein | - |
| EF62_RS12295 (EF62_2398) | - | 2360055..2360237 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| EF62_RS12300 (EF62_2399) | - | 2360277..2360999 (-) | 723 | WP_002364225.1 | phage regulatory protein | - |
| EF62_RS12305 (EF62_2400) | - | 2361038..2361355 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| EF62_RS12310 (EF62_2401) | - | 2361361..2361552 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| EF62_RS12320 (EF62_2402) | - | 2361843..2362187 (+) | 345 | WP_002385819.1 | helix-turn-helix transcriptional regulator | - |
| EF62_RS12325 (EF62_2403) | - | 2362192..2362839 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EF62_RS12330 (EF62_2404) | - | 2362957..2363721 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| EF62_RS12335 (EF62_2405) | - | 2363736..2364065 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| EF62_RS12340 (EF62_2406) | - | 2364140..2365288 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| EF62_RS12345 (EF62_2407) | comGD | 2365316..2365759 (-) | 444 | WP_014524863.1 | competence type IV pilus minor pilin ComGD | - |
| EF62_RS12350 (EF62_2408) | comGC/cglC | 2365801..2366031 (-) | 231 | WP_010818911.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EF62_RS12355 (EF62_2409) | comGB | 2366031..2367077 (-) | 1047 | WP_014524864.1 | competence type IV pilus assembly protein ComGB | - |
Sequence
Protein
Download Length: 76 a.a. Molecular weight: 8596.30 Da Isoelectric Point: 9.5425
>NTDB_id=46105 EF62_RS12350 WP_010818911.1 2365801..2366031(-) (comGC/cglC) [Enterococcus faecalis 62]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIAESQIELYTLEKNKTPSLNELVNEG
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIAESQIELYTLEKNKTPSLNELVNEG
Nucleotide
Download Length: 231 bp
>NTDB_id=46105 EF62_RS12350 WP_010818911.1 2365801..2366031(-) (comGC/cglC) [Enterococcus faecalis 62]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGCAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTAA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGCAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.514 |
97.368 |
0.618 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.514 |
97.368 |
0.618 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.514 |
97.368 |
0.618 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.514 |
97.368 |
0.618 |
| comGC/cglC | Streptococcus mitis SK321 |
62.162 |
97.368 |
0.605 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
62.162 |
97.368 |
0.605 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
59.211 |
100 |
0.592 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
57.333 |
98.684 |
0.566 |
| comYC | Streptococcus mutans UA159 |
57.353 |
89.474 |
0.513 |
| comYC | Streptococcus mutans UA140 |
57.353 |
89.474 |
0.513 |
| comYC | Streptococcus suis isolate S10 |
53.521 |
93.421 |
0.5 |
| comGC | Staphylococcus aureus MW2 |
46.575 |
96.053 |
0.447 |
| comGC | Staphylococcus aureus N315 |
46.575 |
96.053 |
0.447 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.333 |
98.684 |
0.447 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
47.826 |
90.789 |
0.434 |