Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | FOC71_RS02775 | Genome accession | NZ_CP053999 |
| Coordinates | 525650..526018 (+) | Length | 122 a.a. |
| NCBI ID | WP_003074835.1 | Uniprot ID | - |
| Organism | Streptococcus intermedius strain FDAARGOS_769 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 515336..550902 | 525650..526018 | within | 0 |
Gene organization within MGE regions
Location: 515336..550902
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOC71_RS02670 (FOC71_02670) | secE | 515336..515512 (+) | 177 | WP_003074881.1 | preprotein translocase subunit SecE | - |
| FOC71_RS02675 (FOC71_02675) | nusG | 515658..516194 (+) | 537 | WP_003074879.1 | transcription termination/antitermination protein NusG | - |
| FOC71_RS02680 (FOC71_02680) | - | 516402..517199 (+) | 798 | WP_003074878.1 | hypothetical protein | - |
| FOC71_RS02685 (FOC71_02685) | - | 517533..518603 (-) | 1071 | WP_172851985.1 | site-specific integrase | - |
| FOC71_RS02690 (FOC71_02690) | - | 518721..519092 (-) | 372 | WP_003074871.1 | hypothetical protein | - |
| FOC71_RS09810 | - | 519105..519239 (-) | 135 | Protein_502 | ImmA/IrrE family metallo-endopeptidase | - |
| FOC71_RS02695 (FOC71_02695) | - | 519279..520007 (-) | 729 | WP_080564734.1 | XRE family transcriptional regulator | - |
| FOC71_RS02700 (FOC71_02700) | - | 520620..520949 (-) | 330 | WP_003074864.1 | hypothetical protein | - |
| FOC71_RS02705 (FOC71_02705) | - | 520949..521374 (-) | 426 | WP_003074863.1 | hypothetical protein | - |
| FOC71_RS02710 (FOC71_02710) | - | 521443..521649 (+) | 207 | WP_329518383.1 | helix-turn-helix transcriptional regulator | - |
| FOC71_RS02715 (FOC71_02715) | - | 521796..521993 (+) | 198 | WP_003074857.1 | hypothetical protein | - |
| FOC71_RS02720 (FOC71_02720) | - | 522002..522364 (+) | 363 | WP_003074856.1 | hypothetical protein | - |
| FOC71_RS02725 (FOC71_02725) | - | 522386..522670 (+) | 285 | WP_003074854.1 | hypothetical protein | - |
| FOC71_RS02730 (FOC71_02730) | - | 522674..523120 (+) | 447 | WP_003074852.1 | hypothetical protein | - |
| FOC71_RS02735 (FOC71_02735) | - | 523123..523347 (+) | 225 | WP_003074851.1 | hypothetical protein | - |
| FOC71_RS02740 (FOC71_02740) | - | 523349..524062 (+) | 714 | WP_003074849.1 | DUF1642 domain-containing protein | - |
| FOC71_RS02745 (FOC71_02745) | - | 524059..524229 (+) | 171 | WP_003074847.1 | hypothetical protein | - |
| FOC71_RS02750 (FOC71_02750) | - | 524226..524435 (+) | 210 | WP_003074845.1 | hypothetical protein | - |
| FOC71_RS02755 (FOC71_02755) | - | 524419..524838 (+) | 420 | WP_003074843.1 | YopX family protein | - |
| FOC71_RS02760 (FOC71_02760) | - | 524825..525133 (+) | 309 | WP_003074841.1 | hypothetical protein | - |
| FOC71_RS02765 (FOC71_02765) | - | 525136..525402 (+) | 267 | WP_003074839.1 | hypothetical protein | - |
| FOC71_RS02770 (FOC71_02770) | - | 525402..525635 (+) | 234 | WP_003074837.1 | hypothetical protein | - |
| FOC71_RS02775 (FOC71_02775) | ssbA | 525650..526018 (+) | 369 | WP_003074835.1 | single-stranded DNA-binding protein | Machinery gene |
| FOC71_RS02780 (FOC71_02780) | - | 526036..526284 (+) | 249 | WP_003074833.1 | hypothetical protein | - |
| FOC71_RS02785 (FOC71_02785) | - | 526281..527030 (+) | 750 | WP_003074831.1 | site-specific DNA-methyltransferase | - |
| FOC71_RS02790 (FOC71_02790) | - | 527103..528032 (+) | 930 | WP_003074828.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FOC71_RS02795 (FOC71_02795) | - | 528010..528201 (+) | 192 | WP_003074827.1 | hypothetical protein | - |
| FOC71_RS02800 (FOC71_02800) | - | 528206..528643 (+) | 438 | WP_003074824.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FOC71_RS02805 (FOC71_02805) | - | 528751..529317 (+) | 567 | WP_003074822.1 | site-specific integrase | - |
| FOC71_RS02810 (FOC71_02810) | - | 529495..529830 (+) | 336 | WP_003074821.1 | HNH endonuclease | - |
| FOC71_RS02815 (FOC71_02815) | - | 529934..531205 (+) | 1272 | WP_037584648.1 | phage portal protein | - |
| FOC71_RS02820 (FOC71_02820) | - | 531198..532592 (+) | 1395 | WP_003074817.1 | hypothetical protein | - |
| FOC71_RS02825 (FOC71_02825) | - | 532582..532881 (+) | 300 | WP_003074814.1 | hypothetical protein | - |
| FOC71_RS02830 (FOC71_02830) | - | 532989..534407 (+) | 1419 | WP_003074813.1 | hypothetical protein | - |
| FOC71_RS02835 (FOC71_02835) | - | 534489..534947 (+) | 459 | WP_003074812.1 | hypothetical protein | - |
| FOC71_RS02840 (FOC71_02840) | - | 534951..535841 (+) | 891 | WP_003074811.1 | phage major capsid protein | - |
| FOC71_RS02845 (FOC71_02845) | - | 535843..536049 (+) | 207 | WP_003074810.1 | HeH/LEM domain-containing protein | - |
| FOC71_RS02850 (FOC71_02850) | - | 536055..536450 (+) | 396 | WP_003074808.1 | phage Gp19/Gp15/Gp42 family protein | - |
| FOC71_RS02855 (FOC71_02855) | - | 536437..536778 (+) | 342 | WP_003074806.1 | hypothetical protein | - |
| FOC71_RS02860 (FOC71_02860) | - | 536768..536995 (+) | 228 | WP_003074804.1 | hypothetical protein | - |
| FOC71_RS02865 (FOC71_02865) | - | 536996..537331 (+) | 336 | WP_003074802.1 | hypothetical protein | - |
| FOC71_RS02870 (FOC71_02870) | - | 537347..537898 (+) | 552 | WP_003074800.1 | hypothetical protein | - |
| FOC71_RS02875 (FOC71_02875) | - | 537901..538239 (+) | 339 | WP_003074798.1 | hypothetical protein | - |
| FOC71_RS02880 (FOC71_02880) | - | 538254..538628 (+) | 375 | WP_003074796.1 | DUF5361 domain-containing protein | - |
| FOC71_RS02885 (FOC71_02885) | - | 538628..541702 (+) | 3075 | WP_003074794.1 | hypothetical protein | - |
| FOC71_RS02890 (FOC71_02890) | - | 541687..543210 (+) | 1524 | WP_003074791.1 | distal tail protein Dit | - |
| FOC71_RS02895 (FOC71_02895) | - | 543210..547316 (+) | 4107 | WP_003074790.1 | hypothetical protein | - |
| FOC71_RS02900 (FOC71_02900) | - | 547344..547892 (+) | 549 | WP_003074788.1 | hypothetical protein | - |
| FOC71_RS02905 (FOC71_02905) | - | 547910..548194 (+) | 285 | WP_003074787.1 | hypothetical protein | - |
| FOC71_RS02910 (FOC71_02910) | - | 548196..548504 (+) | 309 | WP_003074785.1 | phage holin | - |
| FOC71_RS02915 (FOC71_02915) | - | 548507..549322 (+) | 816 | WP_003074783.1 | lytic exoenzyme target recognition domain-containing protein | - |
| FOC71_RS02920 (FOC71_02920) | - | 549569..550516 (+) | 948 | WP_003074782.1 | Abi family protein | - |
| FOC71_RS02925 (FOC71_02925) | - | 550645..550902 (+) | 258 | WP_003074780.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 122 a.a. Molecular weight: 13949.63 Da Isoelectric Point: 8.4200
>NTDB_id=450000 FOC71_RS02775 WP_003074835.1 525650..526018(+) (ssbA) [Streptococcus intermedius strain FDAARGOS_769]
MINNVVLVGRMTRDAELRYTPQNQAVATFTLAVNRNFKNQSGEREADFINVVIWRQQAENLANWAKKGTLIGITGRIQTR
TYENQQGQHVYVMEVVADNFQILQNRNKAANADSLYGEEPTY
MINNVVLVGRMTRDAELRYTPQNQAVATFTLAVNRNFKNQSGEREADFINVVIWRQQAENLANWAKKGTLIGITGRIQTR
TYENQQGQHVYVMEVVADNFQILQNRNKAANADSLYGEEPTY
Nucleotide
Download Length: 369 bp
>NTDB_id=450000 FOC71_RS02775 WP_003074835.1 525650..526018(+) (ssbA) [Streptococcus intermedius strain FDAARGOS_769]
ATGATAAATAACGTTGTACTTGTGGGTCGGATGACTCGAGATGCCGAACTTCGCTATACTCCGCAAAATCAGGCGGTCGC
AACTTTTACTCTTGCTGTCAATCGCAACTTTAAAAATCAAAGTGGGGAGAGAGAAGCTGATTTTATTAATGTTGTGATTT
GGCGCCAGCAGGCAGAAAATCTTGCAAATTGGGCTAAAAAGGGAACCTTAATCGGGATTACTGGTCGCATTCAGACGCGT
ACCTACGAAAATCAACAAGGCCAACATGTCTATGTGATGGAAGTTGTCGCGGATAATTTTCAAATACTTCAAAATCGGAA
TAAAGCTGCAAATGCGGATAGTCTATATGGGGAAGAACCAACTTATTAG
ATGATAAATAACGTTGTACTTGTGGGTCGGATGACTCGAGATGCCGAACTTCGCTATACTCCGCAAAATCAGGCGGTCGC
AACTTTTACTCTTGCTGTCAATCGCAACTTTAAAAATCAAAGTGGGGAGAGAGAAGCTGATTTTATTAATGTTGTGATTT
GGCGCCAGCAGGCAGAAAATCTTGCAAATTGGGCTAAAAAGGGAACCTTAATCGGGATTACTGGTCGCATTCAGACGCGT
ACCTACGAAAATCAACAAGGCCAACATGTCTATGTGATGGAAGTTGTCGCGGATAATTTTCAAATACTTCAAAATCGGAA
TAAAGCTGCAAATGCGGATAGTCTATATGGGGAAGAACCAACTTATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
64.407 |
96.721 |
0.623 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
66.981 |
86.885 |
0.582 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.982 |
92.623 |
0.5 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
50 |
90.164 |
0.451 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
48.182 |
90.164 |
0.434 |
| ssbB/cilA | Streptococcus mitis SK321 |
48.182 |
90.164 |
0.434 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
47.273 |
90.164 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
47.273 |
90.164 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
47.273 |
90.164 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
47.273 |
90.164 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
44.545 |
90.164 |
0.402 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.593 |
92.623 |
0.385 |