Detailed information NTG0447195

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: GE022_RS00855
• Genome accession: NZ_CP053790
• Coordinates: 143025..143351 (+)
• Length: 108 a.a.
• NCBI ID: WP_164405637.1
• Uniprot ID: -
• Organism: Streptococcus canis strain HL_77_2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 138025..148351

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
GE022_RS00840 (GE022_000840)	-	140662..141027 (+)	366	WP_125073632.1	DUF1033 family protein	-
GE022_RS00845 (GE022_000845)	comYA	141114..142055 (+)	942	WP_003046182.1	competence type IV pilus ATPase ComGA	Machinery gene
GE022_RS00850 (GE022_000850)	comYB	141988..143022 (+)	1035	WP_172758339.1	competence type IV pilus assembly protein ComGB	Machinery gene
GE022_RS00855 (GE022_000855)	comYC	143025..143351 (+)	327	WP_164405637.1	competence type IV pilus major pilin ComGC	Machinery gene
GE022_RS00860 (GE022_000860)	comGD	143326..143754 (+)	429	WP_276509017.1	competence type IV pilus minor pilin ComGD	-
GE022_RS00865 (GE022_000865)	comGE	143762..144007 (+)	246	WP_051026419.1	competence type IV pilus minor pilin ComGE	-
GE022_RS00870 (GE022_000870)	comGF	143988..144428 (+)	441	WP_003046192.1	competence type IV pilus minor pilin ComGF	-
GE022_RS00875 (GE022_000875)	comGG	144406..144786 (+)	381	WP_003046193.1	competence type IV pilus minor pilin ComGG	-
GE022_RS00880 (GE022_000880)	comYH	144836..145789 (+)	954	WP_164405635.1	class I SAM-dependent methyltransferase	Machinery gene
GE022_RS00885 (GE022_000885)	-	145848..147044 (+)	1197	WP_093998734.1	acetate kinase	-
GE022_RS00890 (GE022_000890)	-	147336..147542 (+)	207	WP_164405634.1	helix-turn-helix transcriptional regulator	-
GE022_RS00895 (GE022_000895)	-	147543..147683 (+)	141	Protein_131	type II CAAX prenyl endopeptidase Rce1 family protein	-
GE022_RS10595	-	147701..148138 (+)	438	WP_164228326.1	hypothetical protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12476.44 Da
• Isoelectric Point: 9.6762

>NTDB_id=447195 GE022_RS00855 WP_164405637.1 143025..143351(+) (comYC) [Streptococcus canis strain HL_77_2]
MTNQWNNLRHKKLKGFTLLEMLLVILVISFLMLLFVPNLSKQKDRVTETGHTAVVKLVENQAELYELSQGSKPSLSQLKE
DGSITDKQEKAYRDYYGKHKDEAQKLQP

Nucleotide

• Length: 327 bp

>NTDB_id=447195 GE022_RS00855 WP_164405637.1 143025..143351(+) (comYC) [Streptococcus canis strain HL_77_2]
ATGACAAACCAATGGAACAACTTACGACACAAGAAGCTAAAAGGATTTACTCTTCTAGAAATGTTATTGGTGATTCTTGT
CATCAGTTTTTTGATGCTATTATTTGTGCCAAATTTAAGCAAGCAAAAAGACAGGGTTACCGAGACAGGTCATACCGCTG
TTGTTAAATTAGTGGAGAATCAAGCGGAGCTATATGAATTATCTCAGGGTTCAAAACCAAGTTTGAGCCAACTGAAGGAA
GATGGTAGCATCACTGATAAACAAGAAAAAGCTTATCGCGACTATTATGGCAAACATAAAGATGAAGCTCAAAAATTGCA
ACCTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (12-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	54.369	95.37	0.519
comGC	Lactococcus lactis subsp. cremoris KW2	57.292	88.889	0.509
comGC/cglC	Streptococcus mitis SK321	57.609	85.185	0.491
comGC/cglC	Streptococcus mitis NCTC 12261	56.522	85.185	0.481
comYC	Streptococcus mutans UA140	58.621	80.556	0.472
comYC	Streptococcus mutans UA159	58.621	80.556	0.472
comGC/cglC	Streptococcus pneumoniae Rx1	55.435	85.185	0.472
comGC/cglC	Streptococcus pneumoniae R6	55.435	85.185	0.472
comGC/cglC	Streptococcus pneumoniae TIGR4	55.435	85.185	0.472
comGC/cglC	Streptococcus pneumoniae D39	55.435	85.185	0.472
comYC	Streptococcus suis isolate S10	52.273	81.481	0.426