NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	HPC60_RS12215	Genome accession	NZ_CP053671
Coordinates	2392559..2392882 (-)	Length	107 a.a.
NCBI ID	WP_032943614.1	Uniprot ID	-
Organism	Lactococcus lactis subsp. lactis strain G121
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2387559..2397882

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
HPC60_RS12175 (HPC60_06925)	-	2388086..2388895 (-)	810	WP_014570791.1	metal ABC transporter permease	-
HPC60_RS12180 (HPC60_06930)	-	2388888..2389625 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
HPC60_RS12185 (HPC60_06935)	-	2389802..2390644 (-)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
HPC60_RS12190 (HPC60_06940)	-	2390641..2391078 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
HPC60_RS12195 (HPC60_06945)	comGG	2391168..2391452 (-)	285	WP_025017139.1	competence type IV pilus minor pilin ComGG	Machinery gene
HPC60_RS12200 (HPC60_06950)	comGF	2391491..2391937 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
HPC60_RS12205 (HPC60_06955)	comGE	2391900..2392196 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
HPC60_RS12210 (HPC60_06960)	comGD	2392168..2392584 (-)	417	WP_025017137.1	competence type IV pilus minor pilin ComGD	Machinery gene
HPC60_RS12215 (HPC60_06965)	comGC	2392559..2392882 (-)	324	WP_032943614.1	competence type IV pilus major pilin ComGC	Machinery gene
HPC60_RS12220 (HPC60_06970)	comGB	2392956..2394029 (-)	1074	WP_074453836.1	competence type IV pilus assembly protein ComGB	Machinery gene
HPC60_RS12225 (HPC60_06975)	comGA	2393923..2394861 (-)	939	WP_031561106.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

Download Length: 107 a.a. Molecular weight: 12321.22 Da Isoelectric Point: 4.7146

                                >NTDB_id=446218 HPC60_RS12215 WP_032943614.1 2392559..2392882(-) (comGC) [Lactococcus lactis subsp. lactis strain G121]

MCEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQAQLYELDHDDEKPSLSELLNA

GMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

Download Length: 324 bp

                                >NTDB_id=446218 HPC60_RS12215 WP_032943614.1 2392559..2392882(-) (comGC) [Lactococcus lactis subsp. lactis strain G121]

ATTTGTGAAAAAAAATGCCGTCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAG

TATTTTGATATTACTATTTGTTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAA

AAGTAGTAGAAAGTCAAGCTCAACTTTATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAACGCT

GGGATGATTACTCAAAAACAAATTTCTGCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGA

CTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(12-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Lactococcus lactis subsp. cremoris KW2	85.577	97.196	0.832
comGC/cglC	Streptococcus mitis SK321	56.436	94.393	0.533
comYC	Streptococcus mutans UA159	55.446	94.393	0.523
comYC	Streptococcus mutans UA140	55.446	94.393	0.523
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	92.523	0.523
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	95.327	0.514
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	95.327	0.514
comGC/cglC	Streptococcus pneumoniae D39	53.922	95.327	0.514
comGC/cglC	Streptococcus pneumoniae R6	53.922	95.327	0.514
comGC/cglC	Streptococcus mitis NCTC 12261	58.427	83.178	0.486
comYC	Streptococcus suis isolate S10	56.818	82.243	0.467

Detailed information NTG0446218