Detailed information NTG0433333

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: EGM183_RS08210
• Genome accession: NZ_CP050491
• Coordinates: 1689834..1690109 (-)
• Length: 91 a.a.
• NCBI ID: WP_002366896.1
• Uniprot ID: -
• Organism: Enterococcus faecalis strain EGM183
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1684834..1695109

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EGM183_RS08170 (EGM183_08180)	-	1684880..1685212 (+)	333	WP_002357068.1	hypothetical protein	-
EGM183_RS08175 (EGM183_08185)	-	1685389..1685862 (+)	474	WP_002357065.1	universal stress protein	-
EGM183_RS08180 (EGM183_08190)	-	1685974..1687161 (-)	1188	WP_002357064.1	acetate/propionate family kinase	-
EGM183_RS08185 (EGM183_08195)	-	1687186..1688193 (-)	1008	WP_002357063.1	class I SAM-dependent methyltransferase	-
EGM183_RS08190 (EGM183_08200)	comGG	1688322..1688675 (-)	354	WP_002366892.1	competence type IV pilus minor pilin ComGG	-
EGM183_RS08195 (EGM183_08205)	comGF	1688675..1689109 (-)	435	WP_002366893.1	competence type IV pilus minor pilin ComGF	-
EGM183_RS08200 (EGM183_08210)	-	1689099..1689425 (-)	327	WP_025186644.1	type II secretion system protein	-
EGM183_RS08205 (EGM183_08215)	comGD	1689391..1689837 (-)	447	WP_002366895.1	competence type IV pilus minor pilin ComGD	-
EGM183_RS08210 (EGM183_08220)	comGC/cglC	1689834..1690109 (-)	276	WP_002366896.1	competence type IV pilus major pilin ComGC	Machinery gene
EGM183_RS08215 (EGM183_08225)	comGB	1690109..1691155 (-)	1047	WP_002366897.1	competence type IV pilus assembly protein ComGB	-
EGM183_RS08220 (EGM183_08230)	comGA	1691112..1692080 (-)	969	WP_002374519.1	competence type IV pilus ATPase ComGA	-
EGM183_RS08225 (EGM183_08235)	-	1692321..1693649 (-)	1329	WP_002362058.1	APC family permease	-
EGM183_RS08230 (EGM183_08240)	rlmN	1693939..1695012 (-)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10492.43 Da
• Isoelectric Point: 9.3340

>NTDB_id=433333 EGM183_RS08210 WP_002366896.1 1689834..1690109(-) (comGC/cglC) [Enterococcus faecalis strain EGM183]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVNEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=433333 EGM183_RS08210 WP_002366896.1 1689834..1690109(-) (comGC/cglC) [Enterococcus faecalis strain EGM183]
ATGAAAAAGAAACAAAAATACGCGGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGACAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTATACACTAGAAAAAAATAGGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	48.101	86.813	0.418
comGC	Staphylococcus aureus N315	48.101	86.813	0.418
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396