Detailed information NTG0422299

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: G3T13_RS09895
• Genome accession: NZ_CP048686
• Coordinates: 2009693..2009998 (+)
• Length: 101 a.a.
• NCBI ID: WP_174519819.1
• Uniprot ID: -
• Organism: Lactococcus raffinolactis strain KACC 13441
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2004693..2014998

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
G3T13_RS09875	-	2005495..2005857 (+)	363	WP_061774315.1	hypothetical protein	-
G3T13_RS09880	-	2005854..2007698 (+)	1845	WP_061774316.1	acyltransferase family protein	-
G3T13_RS09885	comGA/cglA/cilD	2007761..2008702 (+)	942	WP_061774317.1	competence type IV pilus ATPase ComGA	Machinery gene
G3T13_RS09890	comYB	2008584..2009669 (+)	1086	WP_306301678.1	competence type IV pilus assembly protein ComGB	Machinery gene
G3T13_RS09895	comYC	2009693..2009998 (+)	306	WP_174519819.1	competence type IV pilus major pilin ComGC	Machinery gene
G3T13_RS11680	comGD	2009949..2010398 (+)	450	WP_275575940.1	competence type IV pilus minor pilin ComGD	-
G3T13_RS09905	comGE	2010370..2010675 (+)	306	WP_082785376.1	competence type IV pilus minor pilin ComGE	-
G3T13_RS09910	-	2010824..2011093 (+)	270	WP_239519114.1	competence type IV pilus minor pilin ComGF	-
G3T13_RS09915	comGG	2011105..2011389 (+)	285	WP_061774321.1	competence type IV pilus minor pilin ComGG	-
G3T13_RS09920	ispE	2011394..2012245 (+)	852	WP_061774322.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
G3T13_RS09925	-	2012329..2013177 (+)	849	WP_061774323.1	aminotransferase class IV	-
G3T13_RS09930	-	2013253..2013702 (+)	450	WP_061774324.1	zinc-dependent MarR family transcriptional regulator	-
G3T13_RS09935	-	2013702..2014472 (+)	771	WP_061774325.1	metal ABC transporter ATP-binding protein	-

Sequence

Protein

• Length: 101 a.a.
• Molecular weight: 11338.21 Da
• Isoelectric Point: 9.9451

>NTDB_id=422299 G3T13_RS09895 WP_174519819.1 2009693..2009998(+) (comYC) [Lactococcus raffinolactis strain KACC 13441]
MKKKIVRAFTLVEMLVVLLVISVLILLFIPNLSKQKETVKNTGNGAVVKVVNSQAELYRLDHTDDVTLGKLVSNGNITQK
QADAYNEYYKKNTTESREIPS

Nucleotide

• Length: 306 bp

>NTDB_id=422299 G3T13_RS09895 WP_174519819.1 2009693..2009998(+) (comYC) [Lactococcus raffinolactis strain KACC 13441]
ATGAAGAAAAAAATAGTACGTGCTTTTACTTTAGTAGAAATGCTAGTTGTTCTTCTTGTCATTAGTGTCTTAATTTTATT
GTTTATCCCCAATCTATCCAAACAAAAAGAGACTGTTAAGAATACAGGAAACGGCGCTGTTGTAAAGGTAGTTAACTCGC
AAGCGGAACTTTATAGATTAGACCATACTGATGATGTTACCTTAGGCAAGCTAGTCAGCAATGGCAATATCACACAAAAA
CAGGCGGATGCTTATAATGAGTATTATAAGAAGAACACAACAGAATCACGTGAAATTCCAAGCTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	66.337	100	0.663
comGC/cglC	Streptococcus mitis SK321	63.636	98.02	0.624
comGC/cglC	Streptococcus mitis NCTC 12261	62.887	96.04	0.604
comYC	Streptococcus mutans UA140	61.616	98.02	0.604
comYC	Streptococcus mutans UA159	61.616	98.02	0.604
comGC/cglC	Streptococcus pneumoniae R6	60.606	98.02	0.594
comGC/cglC	Streptococcus pneumoniae D39	60.606	98.02	0.594
comGC/cglC	Streptococcus pneumoniae Rx1	60.606	98.02	0.594
comGC/cglC	Streptococcus pneumoniae TIGR4	60.606	98.02	0.594
comGC	Lactococcus lactis subsp. cremoris KW2	58.333	95.05	0.554
comYC	Streptococcus suis isolate S10	57.5	79.208	0.455
comGC	Staphylococcus aureus N315	46.835	78.218	0.366
comGC	Staphylococcus aureus MW2	46.835	78.218	0.366