Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | GLO19_RS07320 | Genome accession | NZ_CP046247 |
| Coordinates | 1494986..1495261 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain RF_1_1_25_1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1446397..1514867 | 1494986..1495261 | within | 0 |
Gene organization within MGE regions
Location: 1446397..1514867
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GLO19_RS07005 (GLO19_07230) | - | 1446574..1448751 (-) | 2178 | WP_000804748.1 | membrane protein | - |
| GLO19_RS07010 (GLO19_07235) | - | 1448754..1451201 (-) | 2448 | WP_000331160.1 | ATP-binding protein | - |
| GLO19_RS07015 (GLO19_07240) | - | 1451185..1451577 (-) | 393 | WP_000723888.1 | conjugal transfer protein | - |
| GLO19_RS07020 (GLO19_07245) | - | 1451666..1452163 (-) | 498 | WP_010712901.1 | antirestriction protein ArdA | - |
| GLO19_RS07025 (GLO19_07250) | - | 1452280..1452501 (-) | 222 | WP_001009056.1 | hypothetical protein | - |
| GLO19_RS07030 (GLO19_07255) | mobT | 1452544..1453749 (-) | 1206 | WP_000398284.1 | MobT family relaxase | - |
| GLO19_RS07035 (GLO19_07260) | - | 1453772..1453924 (-) | 153 | WP_000879507.1 | hypothetical protein | - |
| GLO19_RS07040 (GLO19_07265) | - | 1453927..1455312 (-) | 1386 | WP_000813488.1 | FtsK/SpoIIIE domain-containing protein | - |
| GLO19_RS07045 (GLO19_07270) | - | 1455341..1455727 (-) | 387 | WP_000985015.1 | YdcP family protein | - |
| GLO19_RS07050 (GLO19_07275) | - | 1455743..1456057 (-) | 315 | WP_000420682.1 | YdcP family protein | - |
| GLO19_RS07055 (GLO19_07285) | - | 1456508..1456759 (-) | 252 | WP_002364188.1 | hypothetical protein | - |
| GLO19_RS07060 (GLO19_07290) | - | 1456831..1457031 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| GLO19_RS07065 (GLO19_07295) | - | 1457868..1459109 (-) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| GLO19_RS07070 (GLO19_07300) | - | 1459110..1459343 (-) | 234 | WP_002384371.1 | phage holin | - |
| GLO19_RS07075 (GLO19_07305) | - | 1459336..1459557 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| GLO19_RS07080 (GLO19_07310) | - | 1459592..1459747 (-) | 156 | WP_002394568.1 | XkdX family protein | - |
| GLO19_RS07085 (GLO19_07315) | - | 1459749..1460069 (-) | 321 | WP_002394569.1 | hypothetical protein | - |
| GLO19_RS07090 (GLO19_07320) | - | 1460088..1460630 (-) | 543 | WP_002394570.1 | hypothetical protein | - |
| GLO19_RS07095 (GLO19_07325) | - | 1460630..1460917 (-) | 288 | WP_002394572.1 | hypothetical protein | - |
| GLO19_RS07100 (GLO19_07330) | - | 1460914..1461510 (-) | 597 | WP_025191462.1 | hypothetical protein | - |
| GLO19_RS07105 (GLO19_07335) | - | 1461503..1462384 (-) | 882 | WP_010729977.1 | phage baseplate upper protein | - |
| GLO19_RS07110 (GLO19_07340) | - | 1462403..1465210 (-) | 2808 | WP_025191463.1 | phage tail spike protein | - |
| GLO19_RS07115 (GLO19_07345) | - | 1465192..1465926 (-) | 735 | WP_002380434.1 | hypothetical protein | - |
| GLO19_RS07120 (GLO19_07350) | - | 1465916..1468813 (-) | 2898 | WP_002393612.1 | tape measure protein | - |
| GLO19_RS07125 (GLO19_07355) | - | 1469061..1469411 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| GLO19_RS07130 (GLO19_07360) | - | 1469464..1470312 (-) | 849 | WP_002387287.1 | major tail protein | - |
| GLO19_RS07135 (GLO19_07365) | - | 1470313..1470687 (-) | 375 | WP_002393979.1 | DUF6838 family protein | - |
| GLO19_RS07140 (GLO19_07370) | - | 1470690..1471088 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| GLO19_RS07145 (GLO19_07375) | - | 1471081..1471449 (-) | 369 | WP_002393978.1 | hypothetical protein | - |
| GLO19_RS07150 (GLO19_07380) | - | 1471446..1471790 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| GLO19_RS07155 (GLO19_07385) | - | 1471804..1471986 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| GLO19_RS07160 (GLO19_07390) | - | 1472015..1472902 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| GLO19_RS07165 (GLO19_07395) | - | 1472916..1473539 (-) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| GLO19_RS07170 (GLO19_07400) | - | 1473758..1474078 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| GLO19_RS07175 (GLO19_07405) | - | 1474135..1474365 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| GLO19_RS07180 (GLO19_07410) | - | 1474366..1476270 (-) | 1905 | WP_002393613.1 | hypothetical protein | - |
| GLO19_RS07185 (GLO19_07415) | - | 1476245..1477732 (-) | 1488 | WP_002393614.1 | phage portal protein | - |
| GLO19_RS07190 (GLO19_07420) | - | 1477744..1479033 (-) | 1290 | WP_002393615.1 | PBSX family phage terminase large subunit | - |
| GLO19_RS07195 (GLO19_07425) | terS | 1479005..1479808 (-) | 804 | WP_002372038.1 | phage terminase small subunit | - |
| GLO19_RS07200 (GLO19_07430) | - | 1479855..1480571 (-) | 717 | WP_002372040.1 | hypothetical protein | - |
| GLO19_RS07205 (GLO19_07435) | - | 1480664..1480891 (-) | 228 | WP_002372042.1 | hypothetical protein | - |
| GLO19_RS07215 (GLO19_07450) | - | 1482989..1483405 (-) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| GLO19_RS07220 (GLO19_07460) | - | 1484312..1484746 (-) | 435 | WP_002372046.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GLO19_RS07225 (GLO19_07465) | - | 1484755..1485054 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| GLO19_RS07230 (GLO19_07470) | - | 1485055..1485357 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| GLO19_RS07235 (GLO19_07475) | - | 1485361..1486323 (-) | 963 | WP_002372048.1 | Lin1244/Lin1753 domain-containing protein | - |
| GLO19_RS07240 (GLO19_07480) | - | 1486337..1487227 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| GLO19_RS07245 (GLO19_07485) | - | 1487230..1488171 (-) | 942 | WP_002364219.1 | lambda-exonuclease family protein | - |
| GLO19_RS07250 (GLO19_07495) | - | 1488269..1488496 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| GLO19_RS07255 (GLO19_07500) | - | 1488496..1488819 (-) | 324 | WP_002380444.1 | hypothetical protein | - |
| GLO19_RS07260 (GLO19_07505) | - | 1488863..1489048 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| GLO19_RS07265 (GLO19_07510) | - | 1489039..1489233 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| GLO19_RS07270 (GLO19_07515) | - | 1489286..1489468 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| GLO19_RS07275 (GLO19_07520) | - | 1489508..1490230 (-) | 723 | WP_002364225.1 | phage regulatory protein | - |
| GLO19_RS07280 (GLO19_07525) | - | 1490269..1490586 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| GLO19_RS07285 (GLO19_07530) | - | 1490592..1490783 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| GLO19_RS07290 (GLO19_07535) | - | 1491073..1491417 (+) | 345 | WP_002385819.1 | helix-turn-helix transcriptional regulator | - |
| GLO19_RS07295 (GLO19_07540) | - | 1491422..1492069 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GLO19_RS07300 (GLO19_07545) | - | 1492187..1492951 (+) | 765 | WP_002389030.1 | LysM domain-containing protein | - |
| GLO19_RS07305 (GLO19_07550) | - | 1492966..1493295 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| GLO19_RS07310 (GLO19_07555) | - | 1493370..1494518 (+) | 1149 | WP_002389015.1 | site-specific integrase | - |
| GLO19_RS07315 (GLO19_07560) | comGD | 1494546..1494989 (-) | 444 | WP_002384345.1 | competence type IV pilus minor pilin ComGD | - |
| GLO19_RS07320 (GLO19_07565) | comGC/cglC | 1494986..1495261 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GLO19_RS07325 (GLO19_07570) | comGB | 1495261..1496307 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| GLO19_RS07330 (GLO19_07575) | comGA | 1496264..1497232 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| GLO19_RS07335 (GLO19_07580) | - | 1497473..1498801 (-) | 1329 | WP_002360022.1 | amino acid permease | - |
| GLO19_RS07340 (GLO19_07585) | rlmN | 1499091..1500164 (-) | 1074 | WP_002378471.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| GLO19_RS07345 (GLO19_07590) | - | 1500290..1502119 (-) | 1830 | WP_002401809.1 | ABC transporter permease | - |
| GLO19_RS07350 (GLO19_07595) | - | 1502109..1502858 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| GLO19_RS07355 (GLO19_07600) | - | 1502976..1503677 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| GLO19_RS07360 (GLO19_07605) | - | 1503808..1506231 (-) | 2424 | WP_002378474.1 | DNA translocase FtsK | - |
| GLO19_RS07365 (GLO19_07615) | - | 1506545..1507756 (-) | 1212 | WP_002378475.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| GLO19_RS07370 (GLO19_07620) | - | 1507785..1508690 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| GLO19_RS07375 (GLO19_07625) | - | 1508812..1509792 (+) | 981 | WP_002378476.1 | polyprenyl synthetase family protein | - |
| GLO19_RS07380 (GLO19_07630) | cydC | 1509872..1511638 (-) | 1767 | WP_002364246.1 | thiol reductant ABC exporter subunit CydC | - |
| GLO19_RS07385 (GLO19_07635) | cydD | 1511635..1513368 (-) | 1734 | WP_002378477.1 | thiol reductant ABC exporter subunit CydD | - |
| GLO19_RS07390 (GLO19_07640) | cydB | 1513373..1514386 (-) | 1014 | WP_002356976.1 | cytochrome d ubiquinol oxidase subunit II | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=401918 GLO19_RS07320 WP_002356991.1 1494986..1495261(-) (comGC/cglC) [Enterococcus faecalis strain RF_1_1_25_1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=401918 GLO19_RS07320 WP_002356991.1 1494986..1495261(-) (comGC/cglC) [Enterococcus faecalis strain RF_1_1_25_1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |