Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | GKQ55_RS07835 | Genome accession | NZ_CP046112 |
| Coordinates | 1587663..1587938 (-) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain 111540027-2 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1582663..1592938
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GKQ55_RS07795 (GKQ55_08065) | - | 1582891..1583202 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| GKQ55_RS14465 (GKQ55_08070) | - | 1583214..1583381 (-) | 168 | WP_033624736.1 | hypothetical protein | - |
| GKQ55_RS07800 (GKQ55_08075) | - | 1583799..1583996 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| GKQ55_RS07805 (GKQ55_08080) | - | 1584009..1584191 (-) | 183 | WP_002358110.1 | hypothetical protein | - |
| GKQ55_RS07810 (GKQ55_08085) | - | 1584490..1584822 (+) | 333 | WP_002392358.1 | helix-turn-helix domain-containing protein | - |
| GKQ55_RS07815 (GKQ55_08090) | - | 1584840..1585184 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GKQ55_RS07820 (GKQ55_08095) | - | 1585219..1585947 (+) | 729 | WP_010784612.1 | ion transporter | - |
| GKQ55_RS07825 (GKQ55_08100) | - | 1586047..1587195 (+) | 1149 | WP_002388210.1 | site-specific integrase | - |
| GKQ55_RS07830 (GKQ55_08105) | comGD | 1587223..1587666 (-) | 444 | WP_002388212.1 | competence type IV pilus minor pilin ComGD | - |
| GKQ55_RS07835 (GKQ55_08110) | comGC/cglC | 1587663..1587938 (-) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GKQ55_RS07840 (GKQ55_08115) | comGB | 1587938..1588984 (-) | 1047 | WP_002403888.1 | competence type IV pilus assembly protein ComGB | - |
| GKQ55_RS07845 (GKQ55_08120) | comGA | 1588941..1589909 (-) | 969 | WP_002364237.1 | competence type IV pilus ATPase ComGA | - |
| GKQ55_RS07850 (GKQ55_08125) | - | 1590150..1591478 (-) | 1329 | WP_010784613.1 | APC family permease | - |
| GKQ55_RS07855 (GKQ55_08130) | rlmN | 1591768..1592841 (-) | 1074 | WP_002364241.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=401073 GKQ55_RS07835 WP_002364235.1 1587663..1587938(-) (comGC/cglC) [Enterococcus faecalis strain 111540027-2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=401073 GKQ55_RS07835 WP_002364235.1 1587663..1587938(-) (comGC/cglC) [Enterococcus faecalis strain 111540027-2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |