Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | GKQ57_RS05815 | Genome accession | NZ_CP046108 |
| Coordinates | 1255282..1255557 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain 133170041-3 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1255581..1306528 | 1255282..1255557 | flank | 24 |
Gene organization within MGE regions
Location: 1255282..1306528
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GKQ57_RS05815 (GKQ57_06020) | comGC/cglC | 1255282..1255557 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GKQ57_RS05820 (GKQ57_06025) | comGD | 1255554..1255997 (+) | 444 | WP_016617790.1 | competence type IV pilus minor pilin ComGD | - |
| GKQ57_RS05825 (GKQ57_06030) | - | 1256025..1257173 (-) | 1149 | WP_002388210.1 | site-specific integrase | - |
| GKQ57_RS05830 (GKQ57_06035) | - | 1257273..1258001 (-) | 729 | WP_002388208.1 | ion transporter | - |
| GKQ57_RS05835 (GKQ57_06040) | - | 1258059..1258403 (-) | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| GKQ57_RS05840 (GKQ57_06045) | - | 1258422..1258757 (-) | 336 | WP_002388206.1 | helix-turn-helix domain-containing protein | - |
| GKQ57_RS05845 (GKQ57_06050) | - | 1259049..1259231 (+) | 183 | WP_002388205.1 | hypothetical protein | - |
| GKQ57_RS05850 (GKQ57_06055) | - | 1259244..1259441 (+) | 198 | WP_010712611.1 | hypothetical protein | - |
| GKQ57_RS14655 (GKQ57_06060) | - | 1259859..1260026 (+) | 168 | WP_002388204.1 | hypothetical protein | - |
| GKQ57_RS05855 (GKQ57_06065) | - | 1260038..1260349 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| GKQ57_RS05860 (GKQ57_06070) | - | 1260372..1261094 (+) | 723 | WP_002357000.1 | phage regulatory protein | - |
| GKQ57_RS05865 (GKQ57_06075) | - | 1261120..1261308 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| GKQ57_RS05870 (GKQ57_06080) | - | 1261363..1261572 (+) | 210 | WP_002357002.1 | hypothetical protein | - |
| GKQ57_RS05875 (GKQ57_06085) | - | 1261609..1261947 (+) | 339 | WP_002357003.1 | hypothetical protein | - |
| GKQ57_RS05880 (GKQ57_06090) | - | 1262232..1262786 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| GKQ57_RS05885 (GKQ57_06095) | - | 1263006..1263323 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| GKQ57_RS05890 (GKQ57_06100) | - | 1263316..1264050 (+) | 735 | WP_002385820.1 | ERF family protein | - |
| GKQ57_RS05895 (GKQ57_06105) | - | 1264055..1264696 (+) | 642 | WP_002357009.1 | putative HNHc nuclease | - |
| GKQ57_RS05900 (GKQ57_06110) | - | 1264701..1264901 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| GKQ57_RS05905 (GKQ57_06115) | - | 1264901..1265758 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| GKQ57_RS05910 (GKQ57_06120) | - | 1265755..1266162 (+) | 408 | WP_024797260.1 | RusA family crossover junction endodeoxyribonuclease | - |
| GKQ57_RS14660 (GKQ57_06125) | - | 1266442..1266702 (+) | 261 | WP_002357017.1 | hypothetical protein | - |
| GKQ57_RS05915 (GKQ57_06130) | - | 1267069..1267485 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| GKQ57_RS05925 (GKQ57_06145) | - | 1268200..1269108 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| GKQ57_RS05930 (GKQ57_06150) | - | 1269225..1269587 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| GKQ57_RS14720 (GKQ57_06155) | - | 1270058..1270288 (+) | 231 | Protein_1174 | hypothetical protein | - |
| GKQ57_RS05935 (GKQ57_06160) | - | 1270320..1270754 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| GKQ57_RS05940 (GKQ57_06165) | - | 1270735..1272018 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| GKQ57_RS05945 (GKQ57_06170) | - | 1272018..1273502 (+) | 1485 | WP_010785049.1 | phage portal protein | - |
| GKQ57_RS05950 (GKQ57_06175) | - | 1273495..1274421 (+) | 927 | WP_010785048.1 | minor capsid protein | - |
| GKQ57_RS05955 (GKQ57_06180) | - | 1274544..1275179 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| GKQ57_RS05960 (GKQ57_06185) | - | 1275193..1276089 (+) | 897 | WP_002363368.1 | hypothetical protein | - |
| GKQ57_RS05965 (GKQ57_06190) | - | 1276160..1276492 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| GKQ57_RS05970 (GKQ57_06195) | - | 1276489..1276764 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| GKQ57_RS05975 (GKQ57_06200) | - | 1276761..1277099 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| GKQ57_RS05980 (GKQ57_06205) | - | 1277096..1277488 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| GKQ57_RS05985 (GKQ57_06210) | - | 1277507..1278112 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| GKQ57_RS05990 (GKQ57_06215) | - | 1278115..1278423 (+) | 309 | WP_010785047.1 | hypothetical protein | - |
| GKQ57_RS05995 (GKQ57_06220) | - | 1278486..1278884 (+) | 399 | WP_002409775.1 | tail assembly chaperone | - |
| GKQ57_RS06000 (GKQ57_06225) | - | 1278953..1279258 (+) | 306 | WP_002364305.1 | hypothetical protein | - |
| GKQ57_RS06005 (GKQ57_06230) | - | 1279245..1283699 (+) | 4455 | WP_010785046.1 | phage tail tape measure protein | - |
| GKQ57_RS06010 (GKQ57_06235) | - | 1283696..1284418 (+) | 723 | WP_010785045.1 | hypothetical protein | - |
| GKQ57_RS06015 (GKQ57_06240) | - | 1284418..1285863 (+) | 1446 | WP_010712603.1 | phage tail spike protein | - |
| GKQ57_RS06020 (GKQ57_06245) | - | 1285869..1286609 (+) | 741 | WP_025193093.1 | hypothetical protein | - |
| GKQ57_RS06025 (GKQ57_06250) | - | 1286626..1287078 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| GKQ57_RS06030 (GKQ57_06255) | - | 1287097..1287492 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| GKQ57_RS06035 (GKQ57_06260) | - | 1287494..1287616 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| GKQ57_RS06040 (GKQ57_06265) | - | 1287627..1288007 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| GKQ57_RS06045 (GKQ57_06270) | - | 1288144..1289394 (-) | 1251 | WP_002346915.1 | IS110 family transposase | - |
| GKQ57_RS06050 (GKQ57_06275) | - | 1289791..1291050 (+) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| GKQ57_RS06055 (GKQ57_06280) | - | 1291897..1292097 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| GKQ57_RS06060 (GKQ57_06285) | - | 1292169..1292441 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| GKQ57_RS06070 (GKQ57_06295) | hemH | 1293157..1294098 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| GKQ57_RS14890 (GKQ57_06300) | - | 1294396..1294521 (-) | 126 | WP_002357058.1 | hypothetical protein | - |
| GKQ57_RS06075 (GKQ57_06305) | - | 1294900..1295226 (+) | 327 | WP_002390369.1 | type II secretion system protein | - |
| GKQ57_RS06080 (GKQ57_06310) | comGF | 1295216..1295650 (+) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| GKQ57_RS06085 (GKQ57_06315) | comGG | 1295650..1296003 (+) | 354 | WP_002369174.1 | competence type IV pilus minor pilin ComGG | - |
| GKQ57_RS06090 (GKQ57_06320) | - | 1296132..1297139 (+) | 1008 | WP_002372004.1 | class I SAM-dependent methyltransferase | - |
| GKQ57_RS06095 (GKQ57_06325) | - | 1297164..1298351 (+) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| GKQ57_RS06100 (GKQ57_06330) | - | 1298463..1298936 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| GKQ57_RS06105 (GKQ57_06340) | - | 1299252..1299584 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| GKQ57_RS06115 (GKQ57_06350) | - | 1299858..1301135 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| GKQ57_RS06120 (GKQ57_06355) | - | 1301264..1301941 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| GKQ57_RS06125 (GKQ57_06360) | - | 1301898..1302383 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| GKQ57_RS06130 (GKQ57_06365) | prmA | 1302399..1303346 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| GKQ57_RS06135 (GKQ57_06370) | - | 1303348..1304100 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| GKQ57_RS06140 (GKQ57_06375) | - | 1304315..1306528 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=401004 GKQ57_RS05815 WP_002356991.1 1255282..1255557(+) (comGC/cglC) [Enterococcus faecalis strain 133170041-3]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=401004 GKQ57_RS05815 WP_002356991.1 1255282..1255557(+) (comGC/cglC) [Enterococcus faecalis strain 133170041-3]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |