Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | GIO26_RS03935 | Genome accession | NZ_CP046022 |
| Coordinates | 822787..823062 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain BFF1B1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 817787..828062
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GIO26_RS03900 | - | 818349..818822 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| GIO26_RS03905 | - | 818927..820114 (-) | 1188 | WP_002357064.1 | acetate kinase | - |
| GIO26_RS03910 | - | 820139..821146 (-) | 1008 | WP_002380426.1 | class I SAM-dependent methyltransferase | - |
| GIO26_RS03915 | comGG | 821275..821628 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| GIO26_RS03920 | comGF | 821628..822032 (-) | 405 | Protein_781 | competence type IV pilus minor pilin ComGF | - |
| GIO26_RS03925 | - | 822052..822378 (-) | 327 | WP_025189556.1 | type II secretion system protein | - |
| GIO26_RS03930 | comGD | 822344..822790 (-) | 447 | WP_002366895.1 | competence type IV pilus minor pilin ComGD | - |
| GIO26_RS03935 | comGC/cglC | 822787..823062 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GIO26_RS03940 | comGB | 823062..824108 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| GIO26_RS03945 | comGA | 824065..825033 (-) | 969 | WP_207578985.1 | competence type IV pilus ATPase ComGA | - |
| GIO26_RS03950 | - | 825274..826602 (-) | 1329 | WP_002360022.1 | amino acid permease | - |
| GIO26_RS03955 | rlmN | 826892..827965 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=400227 GIO26_RS03935 WP_002356991.1 822787..823062(-) (comGC/cglC) [Enterococcus faecalis strain BFF1B1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=400227 GIO26_RS03935 WP_002356991.1 822787..823062(-) (comGC/cglC) [Enterococcus faecalis strain BFF1B1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |