Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | GFB65_RS07985 | Genome accession | NZ_CP045598 |
| Coordinates | 1673949..1674224 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain TK-P4B | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1668949..1679224
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GFB65_RS07950 (GFB65_08435) | - | 1669504..1669977 (+) | 474 | WP_010717650.1 | universal stress protein | - |
| GFB65_RS07955 (GFB65_08440) | - | 1670089..1671276 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| GFB65_RS07960 (GFB65_08445) | - | 1671301..1672308 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| GFB65_RS07965 (GFB65_08450) | comGG | 1672437..1672790 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| GFB65_RS07970 (GFB65_08455) | comGF | 1672790..1673224 (-) | 435 | WP_194848644.1 | competence type IV pilus minor pilin ComGF | - |
| GFB65_RS07975 (GFB65_08460) | - | 1673214..1673540 (-) | 327 | WP_002370967.1 | type II secretion system protein | - |
| GFB65_RS07980 (GFB65_08465) | comGD | 1673506..1673952 (-) | 447 | WP_002366895.1 | competence type IV pilus minor pilin ComGD | - |
| GFB65_RS07985 (GFB65_08470) | comGC/cglC | 1673949..1674224 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| GFB65_RS07990 (GFB65_08475) | comGB | 1674224..1675270 (-) | 1047 | WP_048941879.1 | competence type IV pilus assembly protein ComGB | - |
| GFB65_RS07995 (GFB65_08480) | comGA | 1675227..1676195 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| GFB65_RS08000 (GFB65_08485) | - | 1676436..1677764 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| GFB65_RS08005 (GFB65_08495) | rlmN | 1678054..1679127 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=395526 GFB65_RS07985 WP_002356991.1 1673949..1674224(-) (comGC/cglC) [Enterococcus faecalis strain TK-P4B]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=395526 GFB65_RS07985 WP_002356991.1 1673949..1674224(-) (comGC/cglC) [Enterococcus faecalis strain TK-P4B]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |