Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | F9293_RS05965 | Genome accession | NZ_CP045045 |
| Coordinates | 1278875..1279150 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain JY32 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1279174..1318661 | 1278875..1279150 | flank | 24 |
Gene organization within MGE regions
Location: 1278875..1318661
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| F9293_RS05965 (F9293_06320) | comGC/cglC | 1278875..1279150 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| F9293_RS05970 (F9293_06325) | comGD | 1279147..1279581 (+) | 435 | Protein_1178 | competence type IV pilus minor pilin ComGD | - |
| F9293_RS05975 (F9293_06330) | - | 1279618..1280766 (-) | 1149 | WP_002378469.1 | tyrosine-type recombinase/integrase | - |
| F9293_RS05980 (F9293_06335) | - | 1280866..1281594 (-) | 729 | WP_002378468.1 | ion transporter | - |
| F9293_RS05985 (F9293_06340) | - | 1281630..1281974 (-) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| F9293_RS05990 (F9293_06345) | - | 1281991..1282323 (-) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| F9293_RS05995 (F9293_06350) | - | 1282635..1282811 (+) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| F9293_RS06000 (F9293_06355) | - | 1282822..1283133 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| F9293_RS06005 (F9293_06360) | - | 1283172..1283897 (+) | 726 | WP_002378466.1 | Rha family transcriptional regulator | - |
| F9293_RS06010 (F9293_06365) | - | 1283923..1284111 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| F9293_RS06015 (F9293_06370) | - | 1284166..1284375 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| F9293_RS14190 | - | 1284412..1284606 (+) | 195 | WP_002378464.1 | hypothetical protein | - |
| F9293_RS06025 (F9293_06385) | - | 1285033..1285587 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| F9293_RS06030 (F9293_06390) | - | 1285807..1286124 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| F9293_RS06035 (F9293_06395) | - | 1286117..1286851 (+) | 735 | WP_002378463.1 | ERF family protein | - |
| F9293_RS06040 (F9293_06400) | - | 1286856..1287497 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| F9293_RS06045 (F9293_06405) | - | 1287502..1287702 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| F9293_RS06050 (F9293_06410) | - | 1287702..1288559 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| F9293_RS06055 (F9293_06415) | - | 1288556..1288963 (+) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| F9293_RS06060 (F9293_06425) | - | 1289871..1290287 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| F9293_RS06070 (F9293_06440) | - | 1291002..1291910 (+) | 909 | WP_002378460.1 | hypothetical protein | - |
| F9293_RS06075 (F9293_06445) | - | 1292027..1292389 (+) | 363 | WP_224800088.1 | hypothetical protein | - |
| F9293_RS14195 (F9293_06450) | - | 1292860..1293090 (+) | 231 | Protein_1199 | hypothetical protein | - |
| F9293_RS06080 (F9293_06455) | - | 1293122..1293556 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| F9293_RS06085 (F9293_06460) | - | 1293537..1294820 (+) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| F9293_RS06090 (F9293_06465) | - | 1294820..1296304 (+) | 1485 | WP_002378458.1 | phage portal protein | - |
| F9293_RS06095 (F9293_06470) | - | 1296297..1297223 (+) | 927 | WP_002378457.1 | minor capsid protein | - |
| F9293_RS06100 (F9293_06475) | - | 1297346..1297981 (+) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| F9293_RS06105 (F9293_06480) | - | 1297995..1298891 (+) | 897 | WP_002378455.1 | hypothetical protein | - |
| F9293_RS06110 (F9293_06485) | - | 1298962..1299294 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| F9293_RS06115 (F9293_06490) | - | 1299291..1299566 (+) | 276 | WP_002378454.1 | hypothetical protein | - |
| F9293_RS06120 (F9293_06495) | - | 1299563..1299901 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| F9293_RS06125 (F9293_06500) | gp17 | 1299898..1300290 (+) | 393 | WP_002363373.1 | tail completion protein gp17 | - |
| F9293_RS06130 (F9293_06505) | - | 1300309..1300914 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| F9293_RS06135 (F9293_06510) | - | 1300917..1301099 (+) | 183 | WP_002378453.1 | hypothetical protein | - |
| F9293_RS06140 (F9293_06515) | - | 1301148..1301720 (+) | 573 | WP_002401805.1 | immunoglobulin-like domain-containing protein | - |
| F9293_RS06145 (F9293_06520) | - | 1301774..1302172 (+) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| F9293_RS06150 (F9293_06525) | - | 1302241..1302546 (+) | 306 | WP_002366371.1 | hypothetical protein | - |
| F9293_RS06155 (F9293_06530) | - | 1302533..1306987 (+) | 4455 | WP_002378448.1 | phage tail tape measure protein | - |
| F9293_RS06160 (F9293_06535) | - | 1306984..1307706 (+) | 723 | WP_002363380.1 | hypothetical protein | - |
| F9293_RS06165 (F9293_06540) | - | 1307706..1309151 (+) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| F9293_RS06170 (F9293_06545) | - | 1309157..1309897 (+) | 741 | WP_002363383.1 | hypothetical protein | - |
| F9293_RS06175 (F9293_06550) | - | 1309914..1310366 (+) | 453 | WP_002363384.1 | hypothetical protein | - |
| F9293_RS06180 (F9293_06555) | - | 1310385..1310780 (+) | 396 | WP_002363385.1 | hypothetical protein | - |
| F9293_RS06185 (F9293_06560) | - | 1310782..1310904 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| F9293_RS06190 (F9293_06565) | - | 1310915..1311295 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| F9293_RS06195 (F9293_06570) | - | 1311308..1312567 (+) | 1260 | WP_002378445.1 | LysM peptidoglycan-binding domain-containing protein | - |
| F9293_RS06200 (F9293_06575) | - | 1313420..1313620 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| F9293_RS06205 (F9293_06580) | - | 1313692..1313964 (+) | 273 | WP_002378444.1 | hypothetical protein | - |
| F9293_RS06215 (F9293_06590) | hemH | 1314680..1315621 (+) | 942 | WP_002357056.1 | ferrochelatase | - |
| F9293_RS06220 (F9293_06600) | - | 1316422..1316748 (+) | 327 | WP_002370967.1 | type II secretion system protein | - |
| F9293_RS06225 (F9293_06605) | comGF | 1316738..1317172 (+) | 435 | WP_002378441.1 | competence type IV pilus minor pilin ComGF | - |
| F9293_RS06230 (F9293_06610) | comGG | 1317172..1317525 (+) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| F9293_RS06235 (F9293_06615) | - | 1317654..1318661 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=391466 F9293_RS05965 WP_002356991.1 1278875..1279150(+) (comGC/cglC) [Enterococcus faecalis strain JY32]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=391466 F9293_RS05965 WP_002356991.1 1278875..1279150(+) (comGC/cglC) [Enterococcus faecalis strain JY32]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |