Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | FOA09_RS08680 | Genome accession | NZ_CP042216 |
| Coordinates | 1765510..1765785 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain L8 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1722392..1765486 | 1765510..1765785 | flank | 24 |
Gene organization within MGE regions
Location: 1722392..1765785
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FOA09_RS08365 (FOA09_08850) | - | 1722392..1723399 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| FOA09_RS08370 (FOA09_08855) | comGG | 1723528..1723881 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| FOA09_RS08375 (FOA09_08860) | comGF | 1723881..1724315 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| FOA09_RS08380 (FOA09_08865) | - | 1724305..1724706 (-) | 402 | WP_241232516.1 | type II secretion system GspH family protein | - |
| FOA09_RS08385 (FOA09_08870) | - | 1724827..1725312 (-) | 486 | WP_123836470.1 | hypothetical protein | - |
| FOA09_RS08390 (FOA09_08875) | - | 1725388..1725858 (-) | 471 | WP_002388442.1 | GNAT family N-acetyltransferase | - |
| FOA09_RS08395 (FOA09_08880) | - | 1725980..1727281 (-) | 1302 | WP_123836447.1 | LysM peptidoglycan-binding domain-containing protein | - |
| FOA09_RS08400 (FOA09_08885) | - | 1727284..1727490 (-) | 207 | WP_002380792.1 | phage holin | - |
| FOA09_RS08405 (FOA09_08890) | - | 1727487..1727708 (-) | 222 | WP_002397443.1 | hypothetical protein | - |
| FOA09_RS08410 (FOA09_08895) | - | 1727736..1727891 (-) | 156 | WP_052864560.1 | XkdX family protein | - |
| FOA09_RS08415 (FOA09_08900) | - | 1727893..1728225 (-) | 333 | WP_123836448.1 | hypothetical protein | - |
| FOA09_RS08420 (FOA09_08905) | - | 1728244..1728786 (-) | 543 | WP_153246937.1 | hypothetical protein | - |
| FOA09_RS08425 (FOA09_08910) | - | 1728786..1729073 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| FOA09_RS08430 (FOA09_08915) | - | 1729070..1729666 (-) | 597 | WP_104877178.1 | hypothetical protein | - |
| FOA09_RS08435 (FOA09_08920) | - | 1729659..1730540 (-) | 882 | WP_104877177.1 | phage baseplate upper protein | - |
| FOA09_RS08440 (FOA09_08925) | - | 1730559..1733366 (-) | 2808 | WP_161971462.1 | phage tail spike protein | - |
| FOA09_RS08445 (FOA09_08930) | - | 1733348..1734082 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| FOA09_RS08450 (FOA09_08935) | - | 1734072..1736969 (-) | 2898 | WP_185066745.1 | tape measure protein | - |
| FOA09_RS08455 (FOA09_08940) | - | 1737217..1737567 (-) | 351 | WP_010820912.1 | hypothetical protein | - |
| FOA09_RS08460 (FOA09_08945) | - | 1737620..1738468 (-) | 849 | WP_010716866.1 | major tail protein | - |
| FOA09_RS08465 (FOA09_08950) | - | 1738469..1738843 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| FOA09_RS08470 (FOA09_08955) | - | 1738846..1739244 (-) | 399 | WP_016633079.1 | HK97 gp10 family phage protein | - |
| FOA09_RS08475 (FOA09_08960) | - | 1739237..1739605 (-) | 369 | WP_002407273.1 | hypothetical protein | - |
| FOA09_RS08480 (FOA09_08965) | - | 1739602..1739946 (-) | 345 | WP_048954256.1 | hypothetical protein | - |
| FOA09_RS08485 (FOA09_08970) | - | 1739960..1740142 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| FOA09_RS08490 (FOA09_08975) | - | 1740171..1741058 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| FOA09_RS08495 (FOA09_08980) | - | 1741072..1741695 (-) | 624 | WP_010820917.1 | DUF4355 domain-containing protein | - |
| FOA09_RS08500 (FOA09_08985) | - | 1741914..1742234 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| FOA09_RS08505 (FOA09_08990) | - | 1742291..1742521 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| FOA09_RS08510 (FOA09_08995) | - | 1742522..1744423 (-) | 1902 | WP_123836451.1 | head protein | - |
| FOA09_RS08515 (FOA09_09000) | - | 1744401..1745885 (-) | 1485 | WP_010708015.1 | phage portal protein | - |
| FOA09_RS08520 (FOA09_09005) | - | 1745897..1747186 (-) | 1290 | WP_002397463.1 | PBSX family phage terminase large subunit | - |
| FOA09_RS08525 (FOA09_09010) | terS | 1747158..1747961 (-) | 804 | WP_123836452.1 | phage terminase small subunit | - |
| FOA09_RS08530 (FOA09_09015) | - | 1748019..1748207 (-) | 189 | WP_104888267.1 | hypothetical protein | - |
| FOA09_RS08535 (FOA09_09020) | - | 1748345..1748536 (-) | 192 | WP_002363360.1 | hypothetical protein | - |
| FOA09_RS08540 (FOA09_09025) | - | 1748574..1749908 (-) | 1335 | WP_123836453.1 | DNA methyltransferase | - |
| FOA09_RS08545 (FOA09_09030) | - | 1749911..1750144 (-) | 234 | WP_002366354.1 | hypothetical protein | - |
| FOA09_RS08555 (FOA09_09045) | - | 1750961..1751377 (-) | 417 | WP_002364337.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FOA09_RS08560 (FOA09_09055) | - | 1751839..1752402 (-) | 564 | WP_123836455.1 | ASCH/PUA domain-containing protein | - |
| FOA09_RS08565 (FOA09_09060) | - | 1752414..1752620 (-) | 207 | WP_123836456.1 | hypothetical protein | - |
| FOA09_RS14500 | - | 1752617..1752751 (-) | 135 | WP_260244166.1 | hypothetical protein | - |
| FOA09_RS08570 (FOA09_09065) | - | 1752751..1753101 (-) | 351 | WP_123836457.1 | hypothetical protein | - |
| FOA09_RS08575 (FOA09_09070) | - | 1753251..1753946 (-) | 696 | WP_228023825.1 | N-6 DNA methylase | - |
| FOA09_RS08580 (FOA09_09075) | - | 1754213..1754398 (-) | 186 | WP_002368217.1 | hypothetical protein | - |
| FOA09_RS08585 (FOA09_09080) | - | 1754398..1754823 (-) | 426 | WP_033658923.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FOA09_RS08590 (FOA09_09085) | - | 1754823..1755776 (-) | 954 | WP_002396626.1 | phage replisome organizer N-terminal domain-containing protein | - |
| FOA09_RS08595 (FOA09_09090) | - | 1755780..1756460 (-) | 681 | WP_002396625.1 | putative HNHc nuclease | - |
| FOA09_RS08600 (FOA09_09095) | - | 1756457..1757395 (-) | 939 | WP_123836471.1 | DUF1351 domain-containing protein | - |
| FOA09_RS08605 (FOA09_09100) | - | 1757380..1758057 (-) | 678 | WP_127341765.1 | ERF family protein | - |
| FOA09_RS08610 (FOA09_09105) | - | 1758041..1758295 (-) | 255 | WP_002368203.1 | hypothetical protein | - |
| FOA09_RS08615 (FOA09_09115) | - | 1758475..1758798 (-) | 324 | WP_010826439.1 | hypothetical protein | - |
| FOA09_RS08620 (FOA09_09120) | - | 1758870..1759613 (-) | 744 | WP_002368200.1 | hypothetical protein | - |
| FOA09_RS08625 (FOA09_09125) | - | 1759626..1760033 (-) | 408 | WP_002363338.1 | hypothetical protein | - |
| FOA09_RS08630 (FOA09_09130) | - | 1760077..1760301 (-) | 225 | WP_099704311.1 | hypothetical protein | - |
| FOA09_RS08635 (FOA09_09135) | - | 1760312..1760497 (-) | 186 | WP_099704312.1 | hypothetical protein | - |
| FOA09_RS08640 (FOA09_09140) | - | 1760508..1761221 (-) | 714 | WP_087548635.1 | Rha family transcriptional regulator | - |
| FOA09_RS08645 (FOA09_09145) | - | 1761260..1761577 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| FOA09_RS08650 (FOA09_09150) | - | 1761583..1761774 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| FOA09_RS08655 (FOA09_09160) | - | 1762067..1762408 (+) | 342 | WP_002396615.1 | helix-turn-helix transcriptional regulator | - |
| FOA09_RS08660 (FOA09_09165) | - | 1762413..1763063 (+) | 651 | WP_123836459.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FOA09_RS08665 (FOA09_09170) | - | 1763159..1763788 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| FOA09_RS08670 (FOA09_09175) | - | 1763894..1765042 (+) | 1149 | WP_002396613.1 | site-specific integrase | - |
| FOA09_RS08675 (FOA09_09180) | comGD | 1765079..1765513 (-) | 435 | Protein_1696 | competence type IV pilus minor pilin ComGD | - |
| FOA09_RS08680 (FOA09_09185) | comGC/cglC | 1765510..1765785 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=376035 FOA09_RS08680 WP_002356991.1 1765510..1765785(-) (comGC/cglC) [Enterococcus faecalis strain L8]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=376035 FOA09_RS08680 WP_002356991.1 1765510..1765785(-) (comGC/cglC) [Enterococcus faecalis strain L8]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |