Detailed information NTG0374978

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: FPL13_RS00700
• Genome accession: NZ_CP041968
• Coordinates: 130196..130513 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0A0P0N5S2
• Organism: Streptococcus sp. KS 6
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 125196..135513

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
FPL13_RS00670 (FPL13_00690)	-	125322..125852 (+)	531	WP_049513225.1	FUSC family protein	-
FPL13_RS00675 (FPL13_00695)	-	125929..126288 (+)	360	WP_049513223.1	MerR family transcriptional regulator	-
FPL13_RS00680 (FPL13_00700)	glnA	126326..127672 (+)	1347	WP_049513221.1	type I glutamate--ammonia ligase	-
FPL13_RS00685 (FPL13_00705)	-	127860..128225 (+)	366	WP_049507022.1	DUF1033 family protein	-
FPL13_RS00690 (FPL13_00710)	comYA	128295..129236 (+)	942	WP_049513218.1	competence type IV pilus ATPase ComGA	Machinery gene
FPL13_RS00695 (FPL13_00715)	comGB	129178..130199 (+)	1022	Protein_137	competence type IV pilus assembly protein ComGB	-
FPL13_RS00700 (FPL13_00720)	comYC	130196..130513 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
FPL13_RS00705 (FPL13_00725)	comYD	130473..130901 (+)	429	WP_049507639.1	competence type IV pilus minor pilin ComGD	Machinery gene
FPL13_RS00710 (FPL13_00730)	comGE/cglE	130873..131166 (+)	294	WP_049513214.1	competence type IV pilus minor pilin ComGE	Machinery gene
FPL13_RS00715 (FPL13_00735)	comGF/cglF	131150..131587 (+)	438	WP_049513212.1	competence type IV pilus minor pilin ComGF	Machinery gene
FPL13_RS00720 (FPL13_00740)	comGG	131568..131894 (+)	327	WP_264340993.1	competence type IV pilus minor pilin ComGG	-
FPL13_RS00725 (FPL13_00745)	-	131966..132918 (+)	953	Protein_143	class I SAM-dependent methyltransferase	-
FPL13_RS00730 (FPL13_00750)	-	132965..134164 (+)	1200	WP_049513208.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=374978 FPL13_RS00700 WP_003028473.1 130196..130513(+) (comYC) [Streptococcus sp. KS 6]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=374978 FPL13_RS00700 WP_003028473.1 130196..130513(+) (comYC) [Streptococcus sp. KS 6]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATCATCAGTGTTTT
GATGCTCTTGTTCGTACCGAATTTGACCAAGCAAAAAGAAGCGGTGACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAAGCGGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACGCTCTCAAAATTAGTCAACGAAGGCACG
ATTACAGACAAGCAAGCGGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCCGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0P0N5S2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543