Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | FIU23_RS06790 | Genome accession | NZ_CP041012 |
| Coordinates | 1359957..1360232 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain FDAARGOS_611 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1360256..1399487 | 1359957..1360232 | flank | 24 |
Gene organization within MGE regions
Location: 1359957..1399487
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FIU23_RS06790 (FIU23_06790) | comGC/cglC | 1359957..1360232 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FIU23_RS06795 (FIU23_06795) | comGD | 1360229..1360672 (+) | 444 | WP_137007137.1 | competence type IV pilus minor pilin ComGD | - |
| FIU23_RS06800 (FIU23_06800) | - | 1360700..1361848 (-) | 1149 | WP_002364359.1 | site-specific integrase | - |
| FIU23_RS06805 (FIU23_06805) | - | 1361945..1362673 (-) | 729 | WP_002364358.1 | potassium channel family protein | - |
| FIU23_RS14580 (FIU23_06810) | - | 1362707..1362781 (-) | 75 | Protein_1243 | ImmA/IrrE family metallo-endopeptidase | - |
| FIU23_RS06815 (FIU23_06815) | - | 1362841..1363746 (-) | 906 | WP_016630909.1 | DUF4352 domain-containing protein | - |
| FIU23_RS06820 (FIU23_06820) | - | 1363840..1364184 (-) | 345 | WP_002364356.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FIU23_RS06825 (FIU23_06825) | - | 1364201..1364533 (-) | 333 | WP_002364355.1 | helix-turn-helix transcriptional regulator | - |
| FIU23_RS06830 (FIU23_06830) | - | 1364845..1365021 (+) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| FIU23_RS06835 (FIU23_06835) | - | 1365032..1365330 (+) | 299 | Protein_1248 | hypothetical protein | - |
| FIU23_RS06840 (FIU23_06840) | - | 1365369..1366094 (+) | 726 | WP_002364352.1 | phage regulatory protein | - |
| FIU23_RS06845 (FIU23_06845) | - | 1366120..1366308 (-) | 189 | WP_002364350.1 | YegP family protein | - |
| FIU23_RS06850 (FIU23_06850) | - | 1366363..1366572 (+) | 210 | WP_002399426.1 | hypothetical protein | - |
| FIU23_RS06855 (FIU23_06855) | - | 1366609..1366947 (+) | 339 | WP_002364347.1 | hypothetical protein | - |
| FIU23_RS06865 (FIU23_06865) | - | 1367232..1367786 (-) | 555 | WP_002357006.1 | hypothetical protein | - |
| FIU23_RS06870 (FIU23_06870) | - | 1368006..1368323 (+) | 318 | WP_002357007.1 | hypothetical protein | - |
| FIU23_RS06875 (FIU23_06875) | - | 1368316..1369050 (+) | 735 | WP_002364345.1 | ERF family protein | - |
| FIU23_RS06880 (FIU23_06880) | - | 1369055..1369696 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| FIU23_RS06885 (FIU23_06885) | - | 1369701..1369901 (+) | 201 | WP_002357010.1 | hypothetical protein | - |
| FIU23_RS06890 (FIU23_06890) | - | 1369901..1370758 (+) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| FIU23_RS06895 (FIU23_06895) | - | 1370755..1371183 (+) | 429 | WP_002364342.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FIU23_RS06900 (FIU23_06900) | - | 1371463..1371723 (+) | 261 | WP_002389926.1 | hypothetical protein | - |
| FIU23_RS06905 (FIU23_06905) | - | 1372091..1372507 (+) | 417 | WP_002364339.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FIU23_RS06915 (FIU23_06915) | - | 1373038..1373652 (+) | 615 | WP_002384355.1 | hypothetical protein | - |
| FIU23_RS06920 (FIU23_06920) | - | 1374188..1374418 (+) | 231 | WP_002364294.1 | hypothetical protein | - |
| FIU23_RS06925 (FIU23_06925) | - | 1374450..1374884 (+) | 435 | WP_002364295.1 | terminase small subunit | - |
| FIU23_RS06930 (FIU23_06930) | - | 1374865..1376148 (+) | 1284 | WP_002364296.1 | PBSX family phage terminase large subunit | - |
| FIU23_RS06935 (FIU23_06935) | - | 1376148..1377632 (+) | 1485 | WP_002364297.1 | phage portal protein | - |
| FIU23_RS06940 (FIU23_06940) | - | 1377625..1378551 (+) | 927 | WP_002364298.1 | minor capsid protein | - |
| FIU23_RS06945 (FIU23_06945) | - | 1378674..1379309 (+) | 636 | WP_010730822.1 | DUF4355 domain-containing protein | - |
| FIU23_RS06950 (FIU23_06950) | - | 1379322..1380218 (+) | 897 | WP_002363368.1 | hypothetical protein | - |
| FIU23_RS06955 (FIU23_06955) | - | 1380289..1380621 (+) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| FIU23_RS06960 (FIU23_06960) | - | 1380618..1380893 (+) | 276 | WP_002364301.1 | hypothetical protein | - |
| FIU23_RS06965 (FIU23_06965) | - | 1380890..1381228 (+) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| FIU23_RS06970 (FIU23_06970) | - | 1381225..1381617 (+) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| FIU23_RS06975 (FIU23_06975) | - | 1381636..1382241 (+) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| FIU23_RS06980 (FIU23_06980) | - | 1382244..1382552 (+) | 309 | WP_002364303.1 | hypothetical protein | - |
| FIU23_RS06985 (FIU23_06985) | - | 1382615..1383013 (+) | 399 | WP_002364304.1 | tail assembly chaperone | - |
| FIU23_RS06990 (FIU23_06990) | - | 1383082..1383387 (+) | 306 | WP_002364305.1 | hypothetical protein | - |
| FIU23_RS06995 (FIU23_06995) | - | 1383374..1387828 (+) | 4455 | WP_002399422.1 | phage tail tape measure protein | - |
| FIU23_RS07000 (FIU23_07000) | - | 1387825..1388547 (+) | 723 | WP_002399421.1 | hypothetical protein | - |
| FIU23_RS07005 (FIU23_07005) | - | 1388547..1389992 (+) | 1446 | WP_002399420.1 | phage tail spike protein | - |
| FIU23_RS07010 (FIU23_07010) | - | 1389998..1390738 (+) | 741 | WP_002399419.1 | hypothetical protein | - |
| FIU23_RS07015 (FIU23_07015) | - | 1390755..1391207 (+) | 453 | WP_002399418.1 | hypothetical protein | - |
| FIU23_RS07020 (FIU23_07020) | - | 1391226..1391621 (+) | 396 | WP_002399417.1 | hypothetical protein | - |
| FIU23_RS07025 (FIU23_07025) | - | 1391623..1391745 (+) | 123 | WP_002368228.1 | XkdX family protein | - |
| FIU23_RS07030 (FIU23_07030) | - | 1391756..1392136 (+) | 381 | WP_002378446.1 | phage holin family protein | - |
| FIU23_RS07035 (FIU23_07035) | - | 1392149..1393408 (+) | 1260 | WP_002365833.1 | LysM peptidoglycan-binding domain-containing protein | - |
| FIU23_RS07040 (FIU23_07040) | - | 1394244..1394444 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| FIU23_RS07045 (FIU23_07045) | - | 1394516..1394767 (+) | 252 | WP_002365832.1 | hypothetical protein | - |
| FIU23_RS07060 (FIU23_07060) | hemH | 1395510..1396451 (+) | 942 | WP_002365831.1 | ferrochelatase | - |
| FIU23_RS07070 (FIU23_07070) | - | 1397248..1397574 (+) | 327 | WP_002393943.1 | type II secretion system protein | - |
| FIU23_RS07075 (FIU23_07075) | comGF | 1397564..1397998 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| FIU23_RS07080 (FIU23_07080) | comGG | 1397998..1398351 (+) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| FIU23_RS07085 (FIU23_07085) | - | 1398480..1399487 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=368820 FIU23_RS06790 WP_002356991.1 1359957..1360232(+) (comGC/cglC) [Enterococcus faecalis strain FDAARGOS_611]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=368820 FIU23_RS06790 WP_002356991.1 1359957..1360232(+) (comGC/cglC) [Enterococcus faecalis strain FDAARGOS_611]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATTGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATTGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |