Detailed information NTG0365164

Bioinformatically predicted

Overview

• Name: ssbB
• Type: Machinery gene
• Locus tag: BV455_RS10285
• Genome accession: NZ_CP040553
• Coordinates: 2027485..2027832 (+)
• Length: 115 a.a.
• NCBI ID: WP_017436452.1
• Uniprot ID: -
• Organism: Saccharococcus caldoxylosilyticus strain ER4B
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2025106..2044333	2027485..2027832	within	0

Gene organization within MGE regions

Location: 2025106..2044333

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BV455_RS10270 (BV455_02080)	-	2025106..2026071 (+)	966	WP_409993877.1	processed acidic surface protein	-
BV455_RS10275 (BV455_02081)	-	2026135..2026665 (+)	531	WP_409993898.1	class D sortase	-
BV455_RS10280 (BV455_02082)	-	2026689..2027141 (-)	453	WP_017436454.1	YwpF-like family protein	-
BV455_RS10285 (BV455_02083)	ssbB	2027485..2027832 (+)	348	WP_017436452.1	single-stranded DNA-binding protein	Machinery gene
BV455_RS10290 (BV455_02084)	-	2028006..2028416 (-)	411	WP_061579130.1	helix-turn-helix domain-containing protein	-
BV455_RS10295 (BV455_02085)	-	2028629..2029129 (+)	501	WP_218687165.1	hypothetical protein	-
BV455_RS20670	-	2029632..2030941 (+)	1310	Protein_2008	peptidoglycan-binding protein	-
BV455_RS10305 (BV455_02088)	wecB	2031364..2032509 (+)	1146	WP_017436448.1	non-hydrolyzing UDP-N-acetylglucosamine 2-epimerase	-
BV455_RS10310 (BV455_02089)	-	2032692..2033015 (+)	324	WP_223845336.1	hypothetical protein	-
BV455_RS10315 (BV455_02090)	-	2033842..2035248 (+)	1407	WP_017436443.1	N-acetylmuramoyl-L-alanine amidase	-
BV455_RS10320 (BV455_02091)	-	2035328..2037247 (+)	1920	WP_042408206.1	S8 family serine peptidase	-
BV455_RS10325 (BV455_02092)	-	2037289..2040954 (-)	3666	WP_218687166.1	S8 family peptidase	-
BV455_RS10330 (BV455_02093)	-	2041167..2042171 (+)	1005	WP_218688035.1	C40 family peptidase	-
BV455_RS10335 (BV455_02094)	-	2042450..2044333 (+)	1884	WP_017436439.1	S-layer homology domain-containing protein	-

Sequence

Protein

• Length: 115 a.a.
• Molecular weight: 12939.67 Da
• Isoelectric Point: 9.0791

>NTDB_id=365164 BV455_RS10285 WP_017436452.1 2027485..2027832(+) (ssbB) [Saccharococcus caldoxylosilyticus strain ER4B]
MINQVVLVGRLTKDPELRYTADGAAVANITLAVARNFRNAEGRVDTDFVPCVLWRKTAENTANYCRKGSMIAVTGRVQTR
NYENKDGQRVYVTEVVAESVRFIGTSKVNEWFEHA

Nucleotide

• Length: 348 bp

>NTDB_id=365164 BV455_RS10285 WP_017436452.1 2027485..2027832(+) (ssbB) [Saccharococcus caldoxylosilyticus strain ER4B]
ATGATTAATCAAGTGGTGCTCGTCGGCCGGTTAACGAAAGATCCGGAACTTCGCTATACCGCCGATGGAGCAGCAGTCGC
TAACATTACGTTAGCAGTAGCAAGAAATTTCCGCAATGCAGAAGGGAGGGTAGATACTGATTTCGTCCCGTGCGTCCTTT
GGCGAAAGACAGCAGAAAACACGGCCAATTATTGCCGAAAAGGCTCGATGATTGCGGTGACGGGACGGGTCCAAACGCGA
AACTATGAAAACAAAGACGGACAGCGTGTCTATGTCACTGAGGTAGTAGCGGAATCTGTCCGCTTTATCGGCACCAGCAA
AGTGAATGAATGGTTCGAGCACGCCTGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-102)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB	Bacillus subtilis subsp. subtilis str. 168	66.99	89.565	0.6
ssbA	Bacillus subtilis subsp. subtilis str. 168	66.019	89.565	0.591
ssb	Latilactobacillus sakei subsp. sakei 23K	60.194	89.565	0.539
ssbB	Streptococcus sobrinus strain NIDR 6715-7	45.631	89.565	0.409
ssbB/cilA	Streptococcus mitis NCTC 12261	44.66	89.565	0.4
ssbB/cilA	Streptococcus pneumoniae TIGR4	44.66	89.565	0.4
ssbA	Streptococcus mutans UA159	43.689	89.565	0.391
ssbB/cilA	Streptococcus pneumoniae Rx1	43.689	89.565	0.391
ssbB/cilA	Streptococcus pneumoniae D39	43.689	89.565	0.391
ssbB/cilA	Streptococcus pneumoniae R6	43.689	89.565	0.391
ssbB/cilA	Streptococcus mitis SK321	43.689	89.565	0.391
ssb	Vibrio cholerae strain A1552	40	91.304	0.365