Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | FAJ42_RS10475 | Genome accession | NZ_CP039548 |
| Coordinates | 1962950..1963225 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain VE18379 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1920601..1981332 | 1962950..1963225 | within | 0 |
Gene organization within MGE regions
Location: 1920601..1981332
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FAJ42_RS10165 | comGG | 1921515..1921868 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| FAJ42_RS10170 | comGF | 1921868..1922302 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| FAJ42_RS10175 | - | 1922292..1922693 (-) | 402 | WP_002383134.1 | type II secretion system protein | - |
| FAJ42_RS17235 | - | 1922997..1923122 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| FAJ42_RS10185 | hemH | 1923419..1924360 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| FAJ42_RS10195 | - | 1925100..1925348 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| FAJ42_RS10200 | - | 1925420..1925620 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| FAJ42_RS10205 | - | 1926457..1927698 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| FAJ42_RS10210 | - | 1927699..1927932 (-) | 234 | WP_002384371.1 | phage holin | - |
| FAJ42_RS10215 | - | 1927925..1928146 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| FAJ42_RS10220 | - | 1928181..1928336 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| FAJ42_RS10225 | - | 1928338..1928658 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| FAJ42_RS10230 | - | 1928672..1929163 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| FAJ42_RS10235 | - | 1929163..1929450 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| FAJ42_RS10240 | - | 1929447..1930043 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| FAJ42_RS10245 | - | 1930036..1930918 (-) | 883 | Protein_1876 | phage baseplate upper protein | - |
| FAJ42_RS10250 | - | 1930937..1933744 (-) | 2808 | WP_002387289.1 | phage tail spike protein | - |
| FAJ42_RS10255 | - | 1933726..1934460 (-) | 735 | WP_011109514.1 | tail protein | - |
| FAJ42_RS10260 | - | 1934450..1937347 (-) | 2898 | WP_002387288.1 | tape measure protein | - |
| FAJ42_RS10265 | gpG | 1937595..1937945 (-) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| FAJ42_RS10270 | - | 1937998..1938846 (-) | 849 | WP_002387287.1 | major tail protein | - |
| FAJ42_RS10275 | - | 1938847..1939221 (-) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| FAJ42_RS10280 | - | 1939224..1939622 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| FAJ42_RS10285 | - | 1939615..1939989 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| FAJ42_RS10290 | - | 1939986..1940330 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| FAJ42_RS10295 | - | 1940344..1940526 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| FAJ42_RS10300 | - | 1940555..1941442 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| FAJ42_RS10305 | - | 1941456..1942079 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| FAJ42_RS10310 | - | 1942298..1942618 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| FAJ42_RS10315 | - | 1942675..1942905 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| FAJ42_RS10320 | - | 1942906..1944810 (-) | 1905 | WP_010706494.1 | head protein | - |
| FAJ42_RS10325 | - | 1944785..1946257 (-) | 1473 | WP_010706495.1 | phage portal protein | - |
| FAJ42_RS10330 | terL | 1946269..1947657 (-) | 1389 | WP_002387276.1 | phage terminase large subunit | - |
| FAJ42_RS10335 | - | 1947650..1948111 (-) | 462 | WP_002383816.1 | helix-turn-helix domain-containing protein | - |
| FAJ42_RS10340 | - | 1948187..1948363 (-) | 177 | WP_010706496.1 | hypothetical protein | - |
| FAJ42_RS10345 | - | 1948547..1949359 (-) | 813 | WP_002383813.1 | hypothetical protein | - |
| FAJ42_RS10350 | - | 1949471..1949704 (-) | 234 | Protein_1897 | hypothetical protein | - |
| FAJ42_RS10355 | - | 1950512..1950757 (-) | 246 | WP_010716537.1 | hypothetical protein | - |
| FAJ42_RS10360 | - | 1950782..1951705 (-) | 924 | WP_002383810.1 | DUF6731 family protein | - |
| FAJ42_RS10375 | - | 1952423..1952839 (-) | 417 | WP_010706497.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| FAJ42_RS10385 | - | 1953747..1954155 (-) | 409 | Protein_1901 | RusA family crossover junction endodeoxyribonuclease | - |
| FAJ42_RS10390 | - | 1954152..1955009 (-) | 858 | WP_002387271.1 | helix-turn-helix domain-containing protein | - |
| FAJ42_RS10395 | - | 1955009..1955209 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| FAJ42_RS17240 | - | 1955214..1955597 (-) | 384 | WP_002383802.1 | putative HNHc nuclease | - |
| FAJ42_RS17245 | - | 1955636..1955854 (-) | 219 | WP_010774222.1 | hypothetical protein | - |
| FAJ42_RS10405 | - | 1955859..1956593 (-) | 735 | WP_002383799.1 | ERF family protein | - |
| FAJ42_RS10410 | - | 1956586..1956903 (-) | 318 | WP_002383798.1 | hypothetical protein | - |
| FAJ42_RS10420 | - | 1957099..1957437 (-) | 339 | WP_002383796.1 | hypothetical protein | - |
| FAJ42_RS10425 | - | 1957474..1957683 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| FAJ42_RS10430 | - | 1957738..1957926 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| FAJ42_RS10435 | - | 1957952..1958674 (-) | 723 | WP_002387270.1 | phage regulatory protein | - |
| FAJ42_RS10440 | - | 1958697..1959008 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| FAJ42_RS10445 | - | 1959020..1959211 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| FAJ42_RS10450 | - | 1959507..1959848 (+) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| FAJ42_RS10455 | - | 1959853..1960503 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| FAJ42_RS10460 | - | 1960599..1961228 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| FAJ42_RS10465 | - | 1961334..1962482 (+) | 1149 | WP_002387264.1 | site-specific integrase | - |
| FAJ42_RS10470 | comGD | 1962519..1962953 (-) | 435 | Protein_1918 | competence type IV pilus minor pilin ComGD | - |
| FAJ42_RS10475 | comGC/cglC | 1962950..1963225 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| FAJ42_RS10480 | comGB | 1963225..1964271 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| FAJ42_RS10485 | comGA | 1964228..1965196 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| FAJ42_RS10490 | - | 1965437..1966765 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| FAJ42_RS10495 | rlmN | 1967056..1968129 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| FAJ42_RS10500 | - | 1968254..1970083 (-) | 1830 | WP_002383725.1 | ABC transporter permease | - |
| FAJ42_RS10505 | - | 1970073..1970822 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| FAJ42_RS10510 | - | 1970940..1971641 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| FAJ42_RS10515 | - | 1971772..1974195 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| FAJ42_RS10525 | - | 1974509..1975720 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| FAJ42_RS10530 | - | 1975749..1976654 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| FAJ42_RS10535 | - | 1976776..1977756 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| FAJ42_RS10540 | cydC | 1977836..1979602 (-) | 1767 | WP_002383727.1 | thiol reductant ABC exporter subunit CydC | - |
| FAJ42_RS10545 | cydD | 1979599..1981332 (-) | 1734 | WP_002378477.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=359617 FAJ42_RS10475 WP_002356991.1 1962950..1963225(-) (comGC/cglC) [Enterococcus faecalis strain VE18379]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=359617 FAJ42_RS10475 WP_002356991.1 1962950..1963225(-) (comGC/cglC) [Enterococcus faecalis strain VE18379]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |