Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO82_RS07825 | Genome accession | NZ_CP038819 |
| Coordinates | 1589100..1589411 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O82 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1584100..1594411
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO82_RS07790 (SaO82_1460) | gcvPA | 1584602..1585948 (-) | 1347 | WP_000019686.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO82_RS07795 (SaO82_1461) | gcvT | 1585968..1587059 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO82_RS07800 (SaO82_1462) | - | 1587218..1587742 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SaO82_RS07805 | - | 1587732..1587878 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO82_RS07810 (SaO82_1463) | comGF | 1587975..1588472 (-) | 498 | WP_029656266.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO82_RS07815 (SaO82_1464) | comGE | 1588390..1588689 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SaO82_RS07820 (SaO82_1465) | comGD | 1588676..1589122 (-) | 447 | WP_001791207.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO82_RS07825 (SaO82_1466) | comGC | 1589100..1589411 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO82_RS07830 (SaO82_1467) | comGB | 1589425..1590495 (-) | 1071 | WP_000776417.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO82_RS07835 (SaO82_1468) | comGA | 1590467..1591441 (-) | 975 | WP_000697222.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO82_RS07840 (SaO82_1469) | - | 1591493..1592116 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO82_RS07845 (SaO82_1470) | - | 1592113..1592442 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO82_RS07850 (SaO82_1471) | - | 1592442..1593428 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| SaO82_RS07855 | - | 1593425..1593628 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=355807 SaO82_RS07825 WP_000472256.1 1589100..1589411(-) (comGC) [Staphylococcus aureus strain O82]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=355807 SaO82_RS07825 WP_000472256.1 1589100..1589411(-) (comGC) [Staphylococcus aureus strain O82]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |