Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO268_RS08205 | Genome accession | NZ_CP038612 |
| Coordinates | 1615607..1615918 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O268 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1610607..1620918
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO268_RS08170 (SaO268_1506) | gcvPA | 1611110..1612456 (-) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO268_RS08175 (SaO268_1507) | gcvT | 1612476..1613567 (-) | 1092 | WP_000093343.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO268_RS08180 (SaO268_1508) | - | 1613725..1614249 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SaO268_RS08185 | - | 1614239..1614385 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO268_RS08190 (SaO268_1509) | comGF | 1614482..1614979 (-) | 498 | WP_078061106.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO268_RS08195 (SaO268_1510) | comGE | 1614897..1615196 (-) | 300 | WP_000844409.1 | hypothetical protein | Machinery gene |
| SaO268_RS08200 (SaO268_1511) | comGD | 1615183..1615629 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO268_RS08205 (SaO268_1512) | comGC | 1615607..1615918 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO268_RS08210 (SaO268_1513) | comGB | 1615932..1617002 (-) | 1071 | WP_000776418.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO268_RS08215 (SaO268_1514) | comGA | 1616974..1617948 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO268_RS08220 (SaO268_1515) | - | 1618000..1618623 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO268_RS08225 (SaO268_1516) | - | 1618620..1618949 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO268_RS08230 (SaO268_1517) | - | 1618949..1619935 (-) | 987 | WP_135830986.1 | ROK family glucokinase | - |
| SaO268_RS08235 | - | 1619932..1620135 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=355187 SaO268_RS08205 WP_000472256.1 1615607..1615918(-) (comGC) [Staphylococcus aureus strain O268]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=355187 SaO268_RS08205 WP_000472256.1 1615607..1615918(-) (comGC) [Staphylococcus aureus strain O268]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |