Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ETT48_RS03985 | Genome accession | NZ_CP035451 |
| Coordinates | 755056..755448 (+) | Length | 130 a.a. |
| NCBI ID | WP_011017370.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm230 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 737127..782388 | 755056..755448 | within | 0 |
Gene organization within MGE regions
Location: 737127..782388
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT48_RS03845 (ETT48_03840) | - | 737127..737720 (+) | 594 | WP_002990099.1 | dTDP-4-dehydrorhamnose 3,5-epimerase family protein | - |
| ETT48_RS03850 (ETT48_03845) | rfbB | 737963..739003 (+) | 1041 | WP_002992973.1 | dTDP-glucose 4,6-dehydratase | - |
| ETT48_RS03855 (ETT48_03850) | - | 739097..740236 (-) | 1140 | WP_063633112.1 | site-specific integrase | - |
| ETT48_RS03860 (ETT48_03855) | - | 740373..741053 (-) | 681 | WP_002990092.1 | hypothetical protein | - |
| ETT48_RS03865 (ETT48_03860) | - | 741091..741825 (-) | 735 | WP_063633113.1 | S24 family peptidase | - |
| ETT48_RS03875 (ETT48_03870) | - | 742184..742342 (+) | 159 | WP_008087431.1 | hypothetical protein | - |
| ETT48_RS03880 (ETT48_03875) | - | 742441..743082 (-) | 642 | WP_001008979.1 | hypothetical protein | - |
| ETT48_RS03885 (ETT48_03880) | - | 743227..744423 (-) | 1197 | WP_011017350.1 | site-specific integrase | - |
| ETT48_RS03890 (ETT48_03885) | - | 744734..745474 (-) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| ETT48_RS03895 (ETT48_03890) | - | 745485..745877 (-) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT48_RS03900 (ETT48_03895) | - | 745881..746231 (-) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| ETT48_RS03905 (ETT48_03900) | - | 746520..746795 (+) | 276 | WP_011017354.1 | hypothetical protein | - |
| ETT48_RS03910 (ETT48_03905) | - | 746830..747042 (+) | 213 | WP_063633114.1 | helix-turn-helix domain-containing protein | - |
| ETT48_RS09505 | - | 747116..747250 (+) | 135 | WP_011017356.1 | hypothetical protein | - |
| ETT48_RS03915 (ETT48_03910) | - | 747370..747870 (-) | 501 | WP_032464978.1 | hypothetical protein | - |
| ETT48_RS03920 (ETT48_03915) | - | 747922..748641 (+) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| ETT48_RS03925 (ETT48_03920) | - | 748715..748972 (+) | 258 | WP_011054421.1 | hypothetical protein | - |
| ETT48_RS03930 (ETT48_03925) | - | 749065..749256 (+) | 192 | WP_011017359.1 | hypothetical protein | - |
| ETT48_RS03935 (ETT48_03930) | - | 749377..749565 (+) | 189 | WP_032461348.1 | hypothetical protein | - |
| ETT48_RS03940 (ETT48_03935) | dnaB | 749552..750892 (+) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| ETT48_RS03945 (ETT48_03940) | - | 750885..751646 (+) | 762 | WP_011017361.1 | conserved phage C-terminal domain-containing protein | - |
| ETT48_RS03950 (ETT48_03945) | - | 751646..752458 (+) | 813 | WP_023611651.1 | ATP-binding protein | - |
| ETT48_RS03955 (ETT48_03950) | - | 752458..752685 (+) | 228 | WP_032467212.1 | hypothetical protein | - |
| ETT48_RS09510 | - | 752699..752824 (+) | 126 | WP_257000584.1 | hypothetical protein | - |
| ETT48_RS03960 (ETT48_03955) | - | 752841..753284 (+) | 444 | WP_011017365.1 | YopX family protein | - |
| ETT48_RS09355 | - | 753281..753451 (+) | 171 | WP_023611649.1 | hypothetical protein | - |
| ETT48_RS03965 (ETT48_03960) | - | 753448..753717 (+) | 270 | WP_011017366.1 | hypothetical protein | - |
| ETT48_RS03970 (ETT48_03965) | - | 753719..754351 (+) | 633 | WP_023611652.1 | N-6 DNA methylase | - |
| ETT48_RS03975 (ETT48_03970) | - | 754356..754841 (+) | 486 | WP_011017368.1 | DUF1642 domain-containing protein | - |
| ETT48_RS03980 (ETT48_03975) | - | 754838..755059 (+) | 222 | WP_011017369.1 | hypothetical protein | - |
| ETT48_RS03985 (ETT48_03980) | ssbA | 755056..755448 (+) | 393 | WP_011017370.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT48_RS03990 (ETT48_03985) | - | 755463..755744 (+) | 282 | WP_011054431.1 | hypothetical protein | - |
| ETT48_RS03995 (ETT48_03990) | - | 755741..756079 (+) | 339 | WP_011017371.1 | helix-turn-helix domain-containing protein | - |
| ETT48_RS04000 (ETT48_03995) | - | 756082..756909 (+) | 828 | WP_011017372.1 | prohibitin family protein | - |
| ETT48_RS04005 (ETT48_04000) | - | 756924..757325 (+) | 402 | WP_011017373.1 | hypothetical protein | - |
| ETT48_RS04010 (ETT48_04005) | - | 757485..758060 (+) | 576 | WP_011054435.1 | site-specific integrase | - |
| ETT48_RS04015 (ETT48_04010) | - | 758214..758507 (+) | 294 | WP_011017375.1 | hypothetical protein | - |
| ETT48_RS04020 (ETT48_04015) | - | 758565..758768 (+) | 204 | WP_011017376.1 | hypothetical protein | - |
| ETT48_RS04025 (ETT48_04020) | - | 758794..759180 (+) | 387 | WP_011017377.1 | hypothetical protein | - |
| ETT48_RS04030 (ETT48_04025) | - | 759173..759478 (+) | 306 | WP_011017378.1 | HNH endonuclease | - |
| ETT48_RS04035 (ETT48_04030) | - | 759619..759936 (+) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| ETT48_RS04040 (ETT48_04035) | - | 759949..761679 (+) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| ETT48_RS04045 (ETT48_04040) | - | 761682..761894 (+) | 213 | WP_136260634.1 | hypothetical protein | - |
| ETT48_RS04050 (ETT48_04045) | - | 762047..763234 (+) | 1188 | WP_063633115.1 | phage portal protein | - |
| ETT48_RS04055 (ETT48_04050) | - | 763215..764021 (+) | 807 | WP_063633116.1 | head maturation protease, ClpP-related | - |
| ETT48_RS04060 (ETT48_04055) | - | 764038..765171 (+) | 1134 | WP_063633117.1 | phage major capsid protein | - |
| ETT48_RS09360 | - | 765182..765355 (+) | 174 | WP_165363099.1 | hypothetical protein | - |
| ETT48_RS04065 (ETT48_04060) | - | 765355..765663 (+) | 309 | WP_063633118.1 | hypothetical protein | - |
| ETT48_RS04070 (ETT48_04065) | - | 765656..766018 (+) | 363 | WP_063633119.1 | hypothetical protein | - |
| ETT48_RS04075 (ETT48_04070) | - | 766020..766418 (+) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| ETT48_RS04080 (ETT48_04075) | - | 766411..766791 (+) | 381 | WP_063633120.1 | hypothetical protein | - |
| ETT48_RS04085 (ETT48_04080) | - | 766803..767387 (+) | 585 | WP_063633121.1 | major tail protein | - |
| ETT48_RS04090 (ETT48_04085) | gpG | 767480..767782 (+) | 303 | WP_063633122.1 | phage tail assembly chaperone G | - |
| ETT48_RS04100 (ETT48_04095) | - | 768008..772108 (+) | 4101 | WP_063633123.1 | phage tail tape measure protein | - |
| ETT48_RS04105 (ETT48_04100) | - | 772121..772891 (+) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| ETT48_RS04110 (ETT48_04105) | - | 772888..774936 (+) | 2049 | WP_063633124.1 | phage tail spike protein | - |
| ETT48_RS04115 (ETT48_04110) | hylP | 774936..776054 (+) | 1119 | WP_136040268.1 | hyaluronoglucosaminidase | - |
| ETT48_RS04120 (ETT48_04115) | - | 776067..777977 (+) | 1911 | WP_136040269.1 | gp58-like family protein | - |
| ETT48_RS04125 (ETT48_04120) | - | 777991..778152 (+) | 162 | WP_002987333.1 | hypothetical protein | - |
| ETT48_RS04130 (ETT48_04125) | - | 778155..778766 (+) | 612 | WP_002990014.1 | DUF1366 domain-containing protein | - |
| ETT48_RS04135 (ETT48_04130) | - | 778777..779073 (+) | 297 | WP_002990012.1 | hypothetical protein | - |
| ETT48_RS04140 (ETT48_04135) | - | 779070..779255 (+) | 186 | WP_002990010.1 | holin | - |
| ETT48_RS04145 (ETT48_04140) | - | 779367..780701 (+) | 1335 | WP_063633060.1 | GH25 family lysozyme | - |
| ETT48_RS04150 (ETT48_04145) | spei | 780975..781652 (+) | 678 | WP_047373492.1 | streptococcal pyrogenic exotoxin SpeI | - |
| ETT48_RS04155 (ETT48_04150) | speh | 781678..782388 (+) | 711 | WP_010922229.1 | streptococcal pyrogenic exotoxin SpeH | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14755.61 Da Isoelectric Point: 6.3209
>NTDB_id=342300 ETT48_RS03985 WP_011017370.1 755056..755448(+) (ssbA) [Streptococcus pyogenes strain emm230]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTR
NYENQQGQRVYVTEVVAESFQILEKRDNTANTSSLADSMPDYGPEPDLPF
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTR
NYENQQGQRVYVTEVVAESFQILEKRDNTANTSSLADSMPDYGPEPDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=342300 ETT48_RS03985 WP_011017370.1 755056..755448(+) (ssbA) [Streptococcus pyogenes strain emm230]
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGGCAAAAAGAGGCTGACTTTATCAATTGTGTCATCT
GGCGAAAGTCTGCCGAGAATTTATCAAACTGGGCTAAAAAAGGGCAATTGATTGCAATAACAGGACGCATACAGACTCGT
AATTATGAAAACCAGCAAGGACAACGTGTCTATGTTACGGAAGTTGTCGCAGAAAGCTTCCAGATTTTGGAGAAGCGTGA
TAACACTGCAAACACAAGCAGTTTAGCTGATAGCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGGCAAAAAGAGGCTGACTTTATCAATTGTGTCATCT
GGCGAAAGTCTGCCGAGAATTTATCAAACTGGGCTAAAAAAGGGCAATTGATTGCAATAACAGGACGCATACAGACTCGT
AATTATGAAAACCAGCAAGGACAACGTGTCTATGTTACGGAAGTTGTCGCAGAAAGCTTCCAGATTTTGGAGAAGCGTGA
TAACACTGCAAACACAAGCAGTTTAGCTGATAGCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
68.224 |
82.308 |
0.562 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
66.972 |
83.846 |
0.562 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.148 |
100 |
0.5 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.853 |
100 |
0.469 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.853 |
100 |
0.469 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.704 |
100 |
0.454 |
| ssbA | Streptococcus mutans UA159 |
43.704 |
100 |
0.454 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
81.538 |
0.438 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
42.636 |
99.231 |
0.423 |