Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ETT51_RS01145 | Genome accession | NZ_CP035448 |
| Coordinates | 193835..194227 (+) | Length | 130 a.a. |
| NCBI ID | WP_032460876.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emm70 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 181688..217880 | 193835..194227 | within | 0 |
Gene organization within MGE regions
Location: 181688..217880
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT51_RS01055 (ETT51_01060) | - | 181688..182920 (-) | 1233 | WP_020833235.1 | transglutaminase domain-containing protein | - |
| ETT51_RS09145 | - | 183296..184438 (-) | 1143 | WP_180383156.1 | tyrosine-type recombinase/integrase | - |
| ETT51_RS01070 (ETT51_01075) | - | 184564..185715 (-) | 1152 | WP_227868769.1 | exonuclease domain-containing protein | - |
| ETT51_RS01075 (ETT51_01080) | - | 185729..186115 (-) | 387 | WP_115250266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT51_RS01080 (ETT51_01085) | - | 186125..186475 (-) | 351 | WP_032467305.1 | helix-turn-helix domain-containing protein | - |
| ETT51_RS01085 (ETT51_01090) | - | 186786..187001 (+) | 216 | WP_002986282.1 | hypothetical protein | - |
| ETT51_RS09410 | - | 187075..187209 (+) | 135 | WP_002986279.1 | hypothetical protein | - |
| ETT51_RS01090 (ETT51_01095) | - | 187206..187940 (+) | 735 | WP_115250270.1 | ORF6C domain-containing protein | - |
| ETT51_RS01095 (ETT51_01100) | - | 188005..188268 (+) | 264 | WP_136098294.1 | hypothetical protein | - |
| ETT51_RS01100 (ETT51_01105) | - | 188283..188471 (+) | 189 | WP_136098295.1 | hypothetical protein | - |
| ETT51_RS01105 (ETT51_01110) | dnaB | 188458..189804 (+) | 1347 | WP_136059219.1 | replicative DNA helicase | - |
| ETT51_RS01110 (ETT51_01115) | - | 189791..190537 (+) | 747 | WP_029713979.1 | conserved phage C-terminal domain-containing protein | - |
| ETT51_RS01115 (ETT51_01120) | - | 190538..191359 (+) | 822 | WP_029713978.1 | ATP-binding protein | - |
| ETT51_RS01120 (ETT51_01125) | - | 191359..191586 (+) | 228 | WP_136271350.1 | hypothetical protein | - |
| ETT51_RS09150 | - | 191600..191770 (+) | 171 | WP_168388561.1 | hypothetical protein | - |
| ETT51_RS01125 (ETT51_01130) | - | 191767..192036 (+) | 270 | WP_109982045.1 | hypothetical protein | - |
| ETT51_RS01130 (ETT51_01135) | - | 192039..192788 (+) | 750 | WP_111685854.1 | DNA-methyltransferase | - |
| ETT51_RS01135 (ETT51_01140) | - | 192836..193552 (+) | 717 | WP_109982044.1 | DUF1642 domain-containing protein | - |
| ETT51_RS01140 (ETT51_01145) | - | 193620..193838 (+) | 219 | WP_111685855.1 | hypothetical protein | - |
| ETT51_RS01145 (ETT51_01150) | ssbA | 193835..194227 (+) | 393 | WP_032460876.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT51_RS01150 (ETT51_01155) | - | 194241..194519 (+) | 279 | WP_029713970.1 | hypothetical protein | - |
| ETT51_RS01155 (ETT51_01165) | - | 194614..194841 (+) | 228 | WP_063629751.1 | hypothetical protein | - |
| ETT51_RS01160 (ETT51_01170) | - | 194813..195277 (+) | 465 | WP_063629750.1 | hypothetical protein | - |
| ETT51_RS01165 (ETT51_01175) | - | 195387..195929 (+) | 543 | WP_063629749.1 | site-specific integrase | - |
| ETT51_RS01170 (ETT51_01180) | - | 196099..196281 (+) | 183 | WP_063629748.1 | hypothetical protein | - |
| ETT51_RS09275 | - | 196670..196864 (+) | 195 | WP_227876734.1 | HNH endonuclease | - |
| ETT51_RS01180 (ETT51_01190) | - | 196982..197467 (+) | 486 | WP_000601034.1 | hypothetical protein | - |
| ETT51_RS01185 (ETT51_01195) | - | 197460..199172 (+) | 1713 | WP_111685857.1 | terminase TerL endonuclease subunit | - |
| ETT51_RS01190 (ETT51_01200) | - | 199181..200323 (+) | 1143 | WP_115223025.1 | phage portal protein | - |
| ETT51_RS01195 (ETT51_01205) | - | 200374..200916 (+) | 543 | WP_063629746.1 | HK97 family phage prohead protease | - |
| ETT51_RS01200 (ETT51_01210) | - | 200927..202189 (+) | 1263 | WP_063629745.1 | phage major capsid protein | - |
| ETT51_RS01205 (ETT51_01215) | - | 202209..202547 (+) | 339 | WP_136098297.1 | hypothetical protein | - |
| ETT51_RS01210 (ETT51_01220) | - | 202544..202849 (+) | 306 | WP_032460893.1 | head-tail adaptor protein | - |
| ETT51_RS01215 (ETT51_01225) | - | 202849..203196 (+) | 348 | WP_032460892.1 | hypothetical protein | - |
| ETT51_RS01220 (ETT51_01230) | - | 203183..203527 (+) | 345 | WP_063629744.1 | hypothetical protein | - |
| ETT51_RS01225 (ETT51_01235) | - | 203542..204213 (+) | 672 | WP_063629743.1 | phage tail protein | - |
| ETT51_RS01230 (ETT51_01240) | - | 204217..204690 (+) | 474 | WP_063629742.1 | hypothetical protein | - |
| ETT51_RS01240 (ETT51_01250) | - | 204880..207615 (+) | 2736 | WP_111685860.1 | phage tail tape measure protein | - |
| ETT51_RS01245 (ETT51_01255) | - | 207612..208334 (+) | 723 | WP_136026304.1 | phage tail protein | - |
| ETT51_RS09470 (ETT51_01260) | - | 208335..210278 (+) | 1944 | WP_281727046.1 | phage tail spike protein | - |
| ETT51_RS01255 (ETT51_01265) | hylP | 210275..211387 (+) | 1113 | WP_136098298.1 | hyaluronoglucosaminidase | - |
| ETT51_RS01260 (ETT51_01270) | - | 211402..213183 (+) | 1782 | WP_136098299.1 | gp58-like family protein | - |
| ETT51_RS01265 (ETT51_01275) | - | 213192..213620 (+) | 429 | WP_011528780.1 | DUF1617 family protein | - |
| ETT51_RS01270 (ETT51_01280) | - | 213623..214261 (+) | 639 | WP_111685863.1 | hypothetical protein | - |
| ETT51_RS01275 (ETT51_01285) | - | 214272..214727 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| ETT51_RS09415 | - | 214729..214851 (+) | 123 | WP_027968869.1 | hypothetical protein | - |
| ETT51_RS01280 (ETT51_01290) | - | 214839..216047 (+) | 1209 | WP_136098300.1 | glucosaminidase domain-containing protein | - |
| ETT51_RS01285 (ETT51_01295) | - | 216120..216323 (-) | 204 | WP_003055570.1 | helix-turn-helix domain-containing protein | - |
| ETT51_RS01290 (ETT51_01300) | speG | 216972..217676 (+) | 705 | Protein_207 | streptococcal pyrogenic exotoxin SpeG | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14837.69 Da Isoelectric Point: 5.8648
>NTDB_id=342112 ETT51_RS01145 WP_032460876.1 193835..194227(+) (ssbA) [Streptococcus pyogenes strain emm70]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVMWRQAAENLTNWTKKGHLIAITGRIQTR
NYENQNGQRVYVTEVVAESFQILEKRDNTANTNSLADTMPDYGPEPDLPF
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVMWRQAAENLTNWTKKGHLIAITGRIQTR
NYENQNGQRVYVTEVVAESFQILEKRDNTANTNSLADTMPDYGPEPDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=342112 ETT51_RS01145 WP_032460876.1 193835..194227(+) (ssbA) [Streptococcus pyogenes strain emm70]
ATGATCAATAACGTTGTCCTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGACAAAAAGAAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAGAAGGGCCATCTGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAGAATGGTCAACGTGTTTACGTGACAGAAGTGGTTGCCGAAAGTTTTCAAATTTTAGAGAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
ATGATCAATAACGTTGTCCTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGACAAAAAGAAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAGAAGGGCCATCTGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAGAATGGTCAACGTGTTTACGTGACAGAAGTGGTTGCCGAAAGTTTTCAAATTTTAGAGAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
67.29 |
82.308 |
0.554 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
64.22 |
83.846 |
0.538 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.97 |
100 |
0.477 |
| ssbA | Streptococcus mutans UA159 |
44.444 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.697 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.939 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.83 |
81.538 |
0.431 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.86 |
99.231 |
0.415 |