Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ETT71_RS01225 | Genome accession | NZ_CP035428 |
| Coordinates | 206019..206411 (+) | Length | 130 a.a. |
| NCBI ID | WP_136106939.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain emmSTG866.1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 194852..244438 | 206019..206411 | within | 0 |
Gene organization within MGE regions
Location: 194852..244438
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ETT71_RS01120 (ETT71_01120) | - | 194852..196084 (-) | 1233 | WP_009880892.1 | transglutaminase domain-containing protein | - |
| ETT71_RS09135 | - | 196460..197602 (-) | 1143 | WP_180383156.1 | site-specific integrase | - |
| ETT71_RS01135 (ETT71_01135) | - | 197729..198262 (-) | 534 | WP_085577383.1 | hypothetical protein | - |
| ETT71_RS01140 (ETT71_01140) | - | 198274..198654 (-) | 381 | WP_002986288.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ETT71_RS01145 (ETT71_01145) | - | 198664..199011 (-) | 348 | WP_085577384.1 | helix-turn-helix domain-containing protein | - |
| ETT71_RS01150 (ETT71_01150) | - | 199302..199466 (+) | 165 | WP_003057272.1 | hypothetical protein | - |
| ETT71_RS01155 (ETT71_01155) | - | 199508..199711 (+) | 204 | WP_003057260.1 | hypothetical protein | - |
| ETT71_RS09275 | - | 199713..199847 (+) | 135 | WP_003057293.1 | hypothetical protein | - |
| ETT71_RS01160 (ETT71_01160) | - | 199844..200212 (+) | 369 | WP_003057274.1 | hypothetical protein | - |
| ETT71_RS01165 (ETT71_01165) | - | 200252..200515 (+) | 264 | WP_136106938.1 | hypothetical protein | - |
| ETT71_RS01170 (ETT71_01170) | - | 200530..200718 (+) | 189 | WP_032460866.1 | hypothetical protein | - |
| ETT71_RS01175 (ETT71_01175) | dnaB | 200705..202045 (+) | 1341 | WP_032464980.1 | replicative DNA helicase | - |
| ETT71_RS01180 (ETT71_01180) | - | 202038..202847 (+) | 810 | WP_136105808.1 | conserved phage C-terminal domain-containing protein | - |
| ETT71_RS01185 (ETT71_01185) | - | 202847..203659 (+) | 813 | WP_032464982.1 | ATP-binding protein | - |
| ETT71_RS01190 (ETT71_01190) | - | 203659..203886 (+) | 228 | WP_011054424.1 | hypothetical protein | - |
| ETT71_RS01195 (ETT71_01195) | - | 203900..204106 (+) | 207 | WP_011054425.1 | hypothetical protein | - |
| ETT71_RS01200 (ETT71_01200) | - | 204123..204392 (+) | 270 | WP_023610894.1 | hypothetical protein | - |
| ETT71_RS01205 (ETT71_01205) | - | 204402..204686 (+) | 285 | WP_032464983.1 | hypothetical protein | - |
| ETT71_RS01210 (ETT71_01210) | - | 204688..205320 (+) | 633 | WP_011054428.1 | N-6 DNA methylase | - |
| ETT71_RS01215 (ETT71_01215) | - | 205325..205804 (+) | 480 | WP_032464990.1 | DUF1642 domain-containing protein | - |
| ETT71_RS01220 (ETT71_01220) | - | 205801..206022 (+) | 222 | WP_011017369.1 | hypothetical protein | - |
| ETT71_RS01225 (ETT71_01225) | ssbA | 206019..206411 (+) | 393 | WP_136106939.1 | single-stranded DNA-binding protein | Machinery gene |
| ETT71_RS01230 (ETT71_01230) | - | 206425..206703 (+) | 279 | WP_029713970.1 | hypothetical protein | - |
| ETT71_RS01235 (ETT71_01235) | - | 206700..207038 (+) | 339 | WP_085577390.1 | helix-turn-helix domain-containing protein | - |
| ETT71_RS01240 (ETT71_01240) | - | 207041..207289 (+) | 249 | WP_085577391.1 | hypothetical protein | - |
| ETT71_RS09140 | - | 207474..207623 (+) | 150 | WP_168391464.1 | hypothetical protein | - |
| ETT71_RS01250 (ETT71_01250) | - | 207592..207792 (+) | 201 | WP_085577392.1 | hypothetical protein | - |
| ETT71_RS01255 (ETT71_01255) | - | 207816..208235 (+) | 420 | WP_085577393.1 | DUF1492 domain-containing protein | - |
| ETT71_RS01260 (ETT71_01260) | - | 208330..208893 (+) | 564 | WP_180383159.1 | site-specific integrase | - |
| ETT71_RS01265 (ETT71_01265) | - | 209065..209358 (+) | 294 | WP_002986191.1 | hypothetical protein | - |
| ETT71_RS01270 (ETT71_01270) | - | 209355..209684 (+) | 330 | WP_085577395.1 | HNH endonuclease | - |
| ETT71_RS01275 (ETT71_01275) | - | 209806..210153 (+) | 348 | WP_136106940.1 | terminase | - |
| ETT71_RS01280 (ETT71_01280) | - | 210134..211792 (+) | 1659 | WP_002986185.1 | terminase TerL endonuclease subunit | - |
| ETT71_RS01285 (ETT71_01285) | - | 211991..213226 (+) | 1236 | WP_003057282.1 | phage portal protein | - |
| ETT71_RS01290 (ETT71_01290) | - | 213230..213946 (+) | 717 | WP_136106941.1 | head maturation protease, ClpP-related | - |
| ETT71_RS01295 (ETT71_01295) | - | 213984..215177 (+) | 1194 | WP_136106942.1 | phage major capsid protein | - |
| ETT71_RS01300 (ETT71_01300) | - | 215192..215479 (+) | 288 | WP_002986176.1 | hypothetical protein | - |
| ETT71_RS01305 (ETT71_01305) | - | 215499..215792 (+) | 294 | WP_003057269.1 | phage gp6-like head-tail connector protein | - |
| ETT71_RS01310 (ETT71_01310) | - | 215794..216171 (+) | 378 | WP_003057300.1 | hypothetical protein | - |
| ETT71_RS01315 (ETT71_01315) | - | 216224..216514 (+) | 291 | WP_227874191.1 | hypothetical protein | - |
| ETT71_RS01320 (ETT71_01320) | - | 216523..216945 (+) | 423 | WP_002986168.1 | hypothetical protein | - |
| ETT71_RS01325 (ETT71_01325) | - | 216964..217551 (+) | 588 | WP_003057267.1 | hypothetical protein | - |
| ETT71_RS01330 (ETT71_01330) | - | 217572..217943 (+) | 372 | WP_071127066.1 | hypothetical protein | - |
| ETT71_RS09145 | - | 217979..218137 (+) | 159 | WP_002986162.1 | hypothetical protein | - |
| ETT71_RS01335 (ETT71_01335) | - | 218211..221447 (+) | 3237 | WP_085577397.1 | phage tail tape measure protein | - |
| ETT71_RS01340 (ETT71_01340) | - | 221447..222154 (+) | 708 | WP_261763409.1 | phage tail domain-containing protein | - |
| ETT71_RS01345 (ETT71_01345) | - | 222151..224202 (+) | 2052 | WP_136106943.1 | phage tail spike protein | - |
| ETT71_RS01350 (ETT71_01350) | - | 224199..225314 (+) | 1116 | WP_136106944.1 | hyaluronoglucosaminidase | - |
| ETT71_RS01355 (ETT71_01355) | - | 225324..227228 (+) | 1905 | WP_136106925.1 | gp58-like family protein | - |
| ETT71_RS01360 (ETT71_01360) | - | 227240..227668 (+) | 429 | WP_011018112.1 | DUF1617 family protein | - |
| ETT71_RS01365 (ETT71_01365) | - | 227671..228276 (+) | 606 | WP_136106947.1 | DUF1366 domain-containing protein | - |
| ETT71_RS01370 (ETT71_01370) | - | 228292..228747 (+) | 456 | WP_002988455.1 | phage holin family protein | - |
| ETT71_RS09280 | - | 228749..228871 (+) | 123 | WP_027968869.1 | hypothetical protein | - |
| ETT71_RS01375 (ETT71_01375) | - | 228859..230067 (+) | 1209 | WP_136106948.1 | glucosaminidase domain-containing protein | - |
| ETT71_RS01380 (ETT71_01380) | - | 230140..230343 (-) | 204 | WP_003055570.1 | helix-turn-helix transcriptional regulator | - |
| ETT71_RS01385 (ETT71_01385) | speG | 230992..231696 (+) | 705 | WP_010921857.1 | streptococcal pyrogenic exotoxin SpeG | - |
| ETT71_RS01390 (ETT71_01390) | - | 232152..233501 (+) | 1350 | WP_011888573.1 | glucose-6-phosphate isomerase | - |
| ETT71_RS01395 (ETT71_01395) | - | 233850..235358 (-) | 1509 | WP_030126942.1 | helix-turn-helix domain-containing protein | - |
| ETT71_RS01400 (ETT71_01400) | - | 236046..236717 (+) | 672 | WP_011054156.1 | rhomboid family intramembrane serine protease | - |
| ETT71_RS01405 (ETT71_01405) | galU | 236816..237715 (-) | 900 | WP_002986125.1 | UTP--glucose-1-phosphate uridylyltransferase GalU | - |
| ETT71_RS01410 (ETT71_01410) | - | 237748..238764 (-) | 1017 | WP_032460614.1 | NAD(P)H-dependent glycerol-3-phosphate dehydrogenase | - |
| ETT71_RS01415 (ETT71_01415) | - | 239062..239511 (+) | 450 | WP_002986120.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| ETT71_RS01420 (ETT71_01420) | - | 239504..241210 (+) | 1707 | WP_010921864.1 | ABC transporter ATP-binding protein | - |
| ETT71_RS01425 (ETT71_01425) | - | 241213..242997 (+) | 1785 | WP_136093695.1 | ABC transporter ATP-binding protein | - |
| ETT71_RS01430 (ETT71_01430) | - | 243115..243882 (+) | 768 | WP_002986113.1 | epoxyqueuosine reductase QueH | - |
| ETT71_RS01435 (ETT71_01435) | - | 243992..244438 (+) | 447 | WP_023079321.1 | dUTP diphosphatase | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14855.73 Da Isoelectric Point: 5.8648
>NTDB_id=341040 ETT71_RS01225 WP_136106939.1 206019..206411(+) (ssbA) [Streptococcus pyogenes strain emmSTG866.1]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVMWRQAAENLTNWTKKGHMIAITGRIQTR
NYENQNGQRVYVTEVVAESFQILEKRDNTANTNSLADTMPDYGPEPDLPF
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVMWRQAAENLTNWTKKGHMIAITGRIQTR
NYENQNGQRVYVTEVVAESFQILEKRDNTANTNSLADTMPDYGPEPDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=341040 ETT71_RS01225 WP_136106939.1 206019..206411(+) (ssbA) [Streptococcus pyogenes strain emmSTG866.1]
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTTGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGACAAAAAGAAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAGAAGGGCCATATGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAGAATGGTCAACGTGTTTACGTGACAGAAGTGGTTGCCGAAAGTTTTCAAATTTTAGAGAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTTGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGACAAAAAGAAGCTGATTTTATTAATTGTGTGATGT
GGCGACAAGCTGCTGAAAATTTAACAAATTGGACTAAGAAGGGCCATATGATTGCGATAACAGGACGCATTCAGACCCGT
AACTATGAGAATCAGAATGGTCAACGTGTTTACGTGACAGAAGTGGTTGCCGAAAGTTTTCAAATTTTAGAGAAGCGTGA
TAATACAGCTAATACTAATAGCTTGGCAGATACCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
66.355 |
82.308 |
0.546 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
63.303 |
83.846 |
0.531 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.212 |
100 |
0.469 |
| ssbA | Streptococcus mutans UA159 |
43.704 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.182 |
100 |
0.438 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.182 |
100 |
0.438 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.182 |
100 |
0.438 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.182 |
100 |
0.438 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.182 |
100 |
0.438 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
81.538 |
0.423 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.085 |
99.231 |
0.408 |