Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SEQ_RS03945 | Genome accession | NC_012471 |
| Coordinates | 792221..792613 (+) | Length | 130 a.a. |
| NCBI ID | WP_012679302.1 | Uniprot ID | - |
| Organism | Streptococcus equi subsp. equi 4047 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 771600..829740 | 792221..792613 | within | 0 |
Gene organization within MGE regions
Location: 771600..829740
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SEQ_RS03825 (SEQ_0777) | - | 771600..772880 (+) | 1281 | WP_012679283.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| SEQ_RS03840 (SEQ_0780) | - | 774384..774974 (+) | 591 | WP_042356873.1 | ABC transporter ATP-binding protein | - |
| SEQ_RS03845 (SEQ_0781) | - | 774984..776546 (+) | 1563 | WP_042356875.1 | ABC transporter ATP-binding protein | - |
| SEQ_RS03850 (SEQ_0782) | prfB | 776929..778030 (+) | 1102 | WP_111692358.1 | peptide chain release factor 2 | - |
| SEQ_RS03855 (SEQ_0783) | ftsE | 778081..778773 (+) | 693 | WP_012678167.1 | cell division ATP-binding protein FtsE | - |
| SEQ_RS03860 (SEQ_0784) | ftsX | 778766..779695 (+) | 930 | WP_042357406.1 | permease-like cell division protein FtsX | - |
| SEQ_RS03865 (SEQ_0785) | - | 780085..780726 (-) | 642 | WP_012679287.1 | MBL fold metallo-hydrolase | - |
| SEQ_RS03870 (SEQ_0786) | - | 781063..783534 (+) | 2472 | WP_012679288.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
| SEQ_RS03875 (SEQ_0787) | - | 783708..784874 (-) | 1167 | WP_012679289.1 | site-specific integrase | - |
| SEQ_RS12105 (SEQ_0788) | - | 785052..785309 (-) | 258 | WP_012679290.1 | phage membrane protein | - |
| SEQ_RS03885 (SEQ_0789) | - | 785634..786038 (-) | 405 | WP_012679291.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SEQ_RS03890 (SEQ_0790) | - | 786052..786402 (-) | 351 | WP_012679292.1 | helix-turn-helix transcriptional regulator | - |
| SEQ_RS03905 (SEQ_0793) | - | 788261..788473 (+) | 213 | WP_012679293.1 | hypothetical protein | - |
| SEQ_RS03910 (SEQ_0794) | - | 788546..788797 (+) | 252 | WP_012679294.1 | hypothetical protein | - |
| SEQ_RS03920 (SEQ_0797) | - | 789073..789414 (+) | 342 | WP_012679297.1 | hypothetical protein | - |
| SEQ_RS03925 (SEQ_0798) | - | 789414..789896 (+) | 483 | WP_012679298.1 | siphovirus Gp157 family protein | - |
| SEQ_RS03930 (SEQ_0799) | - | 789893..790366 (+) | 474 | WP_012679299.1 | hypothetical protein | - |
| SEQ_RS03935 (SEQ_0800) | - | 790326..791450 (+) | 1125 | WP_012679300.1 | DEAD/DEAH box helicase family protein | - |
| SEQ_RS03940 (SEQ_0801) | - | 791510..792220 (+) | 711 | WP_012679301.1 | ERF family protein | - |
| SEQ_RS03945 (SEQ_0802) | ssbA | 792221..792613 (+) | 393 | WP_012679302.1 | single-stranded DNA-binding protein | Machinery gene |
| SEQ_RS03950 (SEQ_0803) | - | 792627..793454 (+) | 828 | WP_012679303.1 | bifunctional DNA primase/polymerase | - |
| SEQ_RS03955 (SEQ_0804) | - | 793438..794838 (+) | 1401 | WP_012679304.1 | virulence-associated E family protein | - |
| SEQ_RS03960 (SEQ_0805) | - | 795194..795388 (+) | 195 | WP_012679305.1 | hypothetical protein | - |
| SEQ_RS03965 (SEQ_0806) | - | 795381..795608 (+) | 228 | WP_012679306.1 | hypothetical protein | - |
| SEQ_RS03970 (SEQ_0807) | - | 795619..796308 (+) | 690 | WP_042356880.1 | site-specific DNA-methyltransferase | - |
| SEQ_RS03975 | - | 796310..797101 (+) | 792 | WP_050315852.1 | DNA cytosine methyltransferase | - |
| SEQ_RS11055 | - | 797094..797588 (+) | 495 | WP_162009867.1 | DNA cytosine methyltransferase | - |
| SEQ_RS03985 (SEQ_0810) | - | 797578..798096 (+) | 519 | WP_012679308.1 | DUF1642 domain-containing protein | - |
| SEQ_RS03990 (SEQ_0811) | - | 798123..798422 (+) | 300 | WP_042357412.1 | hypothetical protein | - |
| SEQ_RS11535 (SEQ_0812) | - | 798439..798612 (+) | 174 | WP_012679310.1 | hypothetical protein | - |
| SEQ_RS03995 (SEQ_0814) | - | 798949..799389 (+) | 441 | WP_012679312.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SEQ_RS04000 (SEQ_0816) | - | 799787..800164 (-) | 378 | WP_012679314.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| SEQ_RS04005 (SEQ_0817) | - | 800216..800401 (-) | 186 | WP_012679315.1 | type II toxin-antitoxin system HicA family toxin | - |
| SEQ_RS04010 (SEQ_0818) | - | 800517..800852 (+) | 336 | WP_012679316.1 | HNH endonuclease signature motif containing protein | - |
| SEQ_RS04015 (SEQ_0819) | - | 801015..801482 (+) | 468 | WP_002985371.1 | phage terminase small subunit P27 family | - |
| SEQ_RS04020 (SEQ_0820) | - | 801497..803251 (+) | 1755 | WP_012679317.1 | terminase TerL endonuclease subunit | - |
| SEQ_RS11725 (SEQ_0821) | - | 803248..803418 (+) | 171 | WP_012679318.1 | hypothetical protein | - |
| SEQ_RS04025 (SEQ_0822) | - | 803411..803677 (+) | 267 | WP_012679319.1 | hypothetical protein | - |
| SEQ_RS04030 (SEQ_0823) | - | 803711..804931 (+) | 1221 | WP_012679320.1 | phage portal protein | - |
| SEQ_RS04035 (SEQ_0824) | - | 804909..805574 (+) | 666 | WP_012679321.1 | head maturation protease, ClpP-related | - |
| SEQ_RS04040 (SEQ_0825) | - | 805599..806786 (+) | 1188 | WP_012679322.1 | phage major capsid protein | - |
| SEQ_RS12060 (SEQ_0826) | - | 806800..806928 (+) | 129 | WP_012679323.1 | hypothetical protein | - |
| SEQ_RS04045 (SEQ_0827) | - | 806931..807233 (+) | 303 | WP_012679324.1 | head-tail connector protein | - |
| SEQ_RS04050 (SEQ_0828) | - | 807230..807577 (+) | 348 | WP_012679325.1 | phage head closure protein | - |
| SEQ_RS04055 (SEQ_0829) | - | 807574..807951 (+) | 378 | WP_012679326.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| SEQ_RS04060 (SEQ_0830) | - | 807948..808373 (+) | 426 | WP_012679327.1 | hypothetical protein | - |
| SEQ_RS04065 (SEQ_0831) | - | 808389..808979 (+) | 591 | WP_012679328.1 | major tail protein | - |
| SEQ_RS04070 (SEQ_0832) | - | 809031..809357 (+) | 327 | WP_012679329.1 | hypothetical protein | - |
| SEQ_RS11670 (SEQ_0833) | - | 809405..809554 (+) | 150 | WP_021299462.1 | hypothetical protein | - |
| SEQ_RS04080 (SEQ_0834) | - | 809567..813226 (+) | 3660 | WP_012679330.1 | phage tail tape measure protein | - |
| SEQ_RS04085 (SEQ_0835) | - | 813226..813933 (+) | 708 | WP_012679331.1 | distal tail protein Dit | - |
| SEQ_RS04090 (SEQ_0836) | - | 813930..816071 (+) | 2142 | WP_012679332.1 | phage tail spike protein | - |
| SEQ_RS04095 (SEQ_0837) | - | 816071..816832 (+) | 762 | WP_012679333.1 | collagen-like protein | - |
| SEQ_RS04100 (SEQ_0838) | - | 816834..817451 (+) | 618 | WP_012679334.1 | hypothetical protein | - |
| SEQ_RS04105 (SEQ_0839) | - | 817462..819345 (+) | 1884 | WP_012679335.1 | gp58-like family protein | - |
| SEQ_RS04110 (SEQ_0840) | - | 819354..819785 (+) | 432 | WP_012679336.1 | DUF1617 family protein | - |
| SEQ_RS04115 (SEQ_0841) | - | 819788..820402 (+) | 615 | WP_012679337.1 | DUF1366 domain-containing protein | - |
| SEQ_RS04120 (SEQ_0842) | - | 820415..820705 (+) | 291 | WP_012679338.1 | hypothetical protein | - |
| SEQ_RS04125 (SEQ_0843) | - | 820708..820887 (+) | 180 | WP_012679339.1 | holin | - |
| SEQ_RS04130 (SEQ_0845) | - | 820999..822195 (+) | 1197 | WP_012679341.1 | glucosaminidase domain-containing protein | - |
| SEQ_RS04135 (SEQ_0846) | - | 822330..822872 (+) | 543 | WP_012679342.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| SEQ_RS11540 (SEQ_0847) | - | 822876..823712 (+) | 837 | WP_012679343.1 | hypothetical protein | - |
| SEQ_RS04145 (SEQ_0849) | - | 824084..824659 (+) | 576 | WP_012679345.1 | phospholipase A2 SlaA | - |
| SEQ_RS11870 (SEQ_0850) | - | 824653..824940 (+) | 288 | WP_011106694.1 | hypothetical protein | - |
| SEQ_RS04155 (SEQ_0851) | prx | 825008..825190 (+) | 183 | WP_012679346.1 | hypothetical protein | Regulator |
| SEQ_RS04160 (SEQ_0852) | - | 825382..825777 (+) | 396 | WP_228275436.1 | DUF5590 domain-containing protein | - |
| SEQ_RS04165 (SEQ_0853) | - | 825774..826985 (+) | 1212 | WP_012679347.1 | pyridoxal phosphate-dependent aminotransferase | - |
| SEQ_RS04170 (SEQ_0854) | asnS | 826998..828344 (+) | 1347 | WP_012679348.1 | asparagine--tRNA ligase | - |
| SEQ_RS04175 (SEQ_0855) | - | 828646..829740 (+) | 1095 | WP_012679349.1 | LPXTG cell wall anchor domain-containing protein | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14989.81 Da Isoelectric Point: 4.8660
>NTDB_id=33516 SEQ_RS03945 WP_012679302.1 792221..792613(+) (ssbA) [Streptococcus equi subsp. equi 4047]
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRAFKSQNGEREADFINCVIWRQQAENLANWAKKGVLIGITGRIQTR
NYENQQGQRVYVTEVVADNFKMLEYRQQQQQEDSFDNNNPMDIQADDLPF
MINNVVLVGRMTKDAELRYTPSQVAVATFTLAVNRAFKSQNGEREADFINCVIWRQQAENLANWAKKGVLIGITGRIQTR
NYENQQGQRVYVTEVVADNFKMLEYRQQQQQEDSFDNNNPMDIQADDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=33516 SEQ_RS03945 WP_012679302.1 792221..792613(+) (ssbA) [Streptococcus equi subsp. equi 4047]
ATGATTAATAATGTAGTACTAGTTGGTCGTATGACCAAGGACGCAGAGCTTCGATACACTCCAAGTCAGGTGGCAGTTGC
TACGTTTACACTTGCTGTTAATCGCGCCTTTAAGAGCCAAAATGGTGAGCGCGAAGCGGATTTCATTAACTGTGTGATCT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCGAAAAAGGGTGTCTTGATTGGGATTACAGGACGTATTCAGACCCGT
AACTACGAAAACCAACAGGGGCAGCGTGTGTATGTAACCGAGGTTGTTGCAGATAATTTCAAAATGCTGGAATACCGCCA
GCAACAGCAGCAAGAGGATTCATTCGATAATAACAATCCAATGGATATTCAGGCTGACGACTTGCCATTCTAA
ATGATTAATAATGTAGTACTAGTTGGTCGTATGACCAAGGACGCAGAGCTTCGATACACTCCAAGTCAGGTGGCAGTTGC
TACGTTTACACTTGCTGTTAATCGCGCCTTTAAGAGCCAAAATGGTGAGCGCGAAGCGGATTTCATTAACTGTGTGATCT
GGCGTCAGCAAGCTGAAAATTTAGCTAACTGGGCGAAAAAGGGTGTCTTGATTGGGATTACAGGACGTATTCAGACCCGT
AACTACGAAAACCAACAGGGGCAGCGTGTGTATGTAACCGAGGTTGTTGCAGATAATTTCAAAATGCTGGAATACCGCCA
GCAACAGCAGCAAGAGGATTCATTCGATAATAACAATCCAATGGATATTCAGGCTGACGACTTGCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.163 |
100 |
0.677 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
69.369 |
85.385 |
0.592 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.185 |
100 |
0.469 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.982 |
86.923 |
0.469 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.697 |
100 |
0.454 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.939 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.939 |
100 |
0.446 |
| ssbA | Streptococcus mutans UA159 |
41.667 |
100 |
0.423 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
40.31 |
99.231 |
0.4 |