Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO267_RS08350 | Genome accession | NZ_CP034102 |
| Coordinates | 1633625..1633936 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O267 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1628625..1638936
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO267_RS08315 (SaO267_01537) | gcvPA | 1629128..1630474 (-) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO267_RS08320 (SaO267_01538) | gcvT | 1630494..1631585 (-) | 1092 | WP_000093343.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO267_RS08325 (SaO267_01539) | - | 1631743..1632267 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| SaO267_RS08330 | - | 1632257..1632403 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO267_RS08335 (SaO267_01540) | comGF | 1632500..1632997 (-) | 498 | WP_078061106.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO267_RS08340 (SaO267_01541) | comGE | 1632915..1633214 (-) | 300 | WP_000844409.1 | hypothetical protein | Machinery gene |
| SaO267_RS08345 (SaO267_01542) | comGD | 1633201..1633647 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO267_RS08350 (SaO267_01543) | comGC | 1633625..1633936 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO267_RS08355 (SaO267_01544) | comGB | 1633950..1635020 (-) | 1071 | WP_000776418.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO267_RS08360 (SaO267_01545) | comGA | 1634992..1635966 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO267_RS08365 (SaO267_01546) | - | 1636018..1636641 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO267_RS08370 (SaO267_01547) | - | 1636638..1636967 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO267_RS08375 (SaO267_01548) | - | 1636967..1637953 (-) | 987 | WP_126117023.1 | ROK family glucokinase | - |
| SaO267_RS08380 | - | 1637950..1638153 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=329006 SaO267_RS08350 WP_000472256.1 1633625..1633936(-) (comGC) [Staphylococcus aureus strain O267]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=329006 SaO267_RS08350 WP_000472256.1 1633625..1633936(-) (comGC) [Staphylococcus aureus strain O267]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |