Detailed information NTG0032875

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: SP670_RS10785
• Genome accession: NC_014498
• Coordinates: 1989514..1989780 (-)
• Length: 88 a.a.
• NCBI ID: WP_000962026.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae 670-6B
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1984514..1994780

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SP670_RS10740 (SP670_2122)	rnpA	1984539..1984910 (-)	372	WP_000739241.1	ribonuclease P protein component	-
SP670_RS10745 (SP670_2123)	-	1985058..1986248 (-)	1191	WP_000167766.1	acetate kinase	-
SP670_RS10750 (SP670_2124)	comGH	1986299..1987252 (-)	954	WP_000345085.1	class I SAM-dependent methyltransferase	Machinery gene
SP670_RS13660	-	1987313..1987900 (-)	588	Protein_2022	class I SAM-dependent methyltransferase	-
SP670_RS10765 (SP670_2127)	comGG/cglG	1988037..1988450 (-)	414	WP_000265619.1	competence type IV pilus minor pilin ComGG	Machinery gene
SP670_RS10770 (SP670_2128)	comGF/cglF	1988428..1988889 (-)	462	WP_000250523.1	competence type IV pilus minor pilin ComGF	Machinery gene
SP670_RS10775 (SP670_2129)	comGE/cglE	1988852..1989154 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
SP670_RS10780 (SP670_2130)	comGD/cglD	1989117..1989521 (-)	405	WP_000588005.1	competence type IV pilus minor pilin ComGD	Machinery gene
SP670_RS10785 (SP670_2131)	comGC/cglC	1989514..1989780 (-)	267	WP_000962026.1	competence type IV pilus major pilin ComGC	Machinery gene
SP670_RS10790 (SP670_2132)	-	1989782..1990039 (-)	258	WP_000698513.1	hypothetical protein	-
SP670_RS10795 (SP670_2133)	-	1990271..1991227 (-)	957	WP_000350474.1	N-acetylmuramoyl-L-alanine amidase family protein	-
SP670_RS10800 (SP670_2134)	-	1991227..1991562 (-)	336	WP_001186218.1	phage holin	-
SP670_RS10805 (SP670_2135)	-	1991566..1991865 (-)	300	WP_001811580.1	hypothetical protein	-
SP670_RS10810 (SP670_2136)	-	1991874..1992224 (-)	351	WP_000852245.1	hypothetical protein	-
SP670_RS10815 (SP670_2137)	-	1992227..1992430 (-)	204	WP_001091115.1	hypothetical protein	-
SP670_RS14675 (SP670_2138)	-	1992411..1992527 (-)	117	WP_001063633.1	hypothetical protein	-

Sequence

Protein

• Length: 88 a.a.
• Molecular weight: 9818.31 Da
• Isoelectric Point: 7.0116

>NTDB_id=32875 SP670_RS10785 WP_000962026.1 1989514..1989780(-) (comGC/cglC) [Streptococcus pneumoniae 670-6B]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNG
VANRKVND

Nucleotide

• Length: 267 bp

>NTDB_id=32875 SP670_RS10785 WP_000962026.1 1989514..1989780(-) (comGC/cglC) [Streptococcus pneumoniae 670-6B]
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTACAAGCAGATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGA
GTAGCAAATCGTAAAGTCAATGATTAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	97.727	100	0.977
comGC/cglC	Streptococcus pneumoniae D39	97.727	100	0.977
comGC/cglC	Streptococcus pneumoniae R6	97.727	100	0.977
comGC/cglC	Streptococcus pneumoniae TIGR4	96.591	100	0.966
comGC/cglC	Streptococcus mitis SK321	93.243	84.091	0.784
comGC/cglC	Streptococcus mitis NCTC 12261	91.176	77.273	0.705
comGC	Streptococcus gordonii str. Challis substr. CH1	72.5	90.909	0.659
comGC	Streptococcus suis isolate S10	68.056	81.818	0.557
comGC	Streptococcus mutans UA140	61.429	79.545	0.489
comGC	Streptococcus mutans UA159	61.429	79.545	0.489
comGC	Lactococcus lactis subsp. cremoris KW2	50.667	85.227	0.432
comGC	Staphylococcus aureus MW2	47.826	78.409	0.375
comGC	Staphylococcus aureus N315	47.826	78.409	0.375