Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   FNL90_RS00675 Genome accession   NZ_CP041408
Coordinates   104522..104806 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain 37-97S     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99522..109806
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNL90_RS00650 (FNL90_00665) - 101468..101833 (+) 366 WP_002986560.1 DUF1033 family protein -
  FNL90_RS00655 (FNL90_00670) comGA 101926..102864 (+) 939 WP_009880361.1 competence type IV pilus ATPase ComGA Machinery gene
  FNL90_RS00660 (FNL90_00675) comGB 102800..103834 (+) 1035 WP_011054115.1 competence type IV pilus assembly protein ComGB Machinery gene
  FNL90_RS00665 (FNL90_00680) comGC 103836..104162 (+) 327 WP_012560386.1 competence type IV pilus major pilin ComGC Machinery gene
  FNL90_RS00670 (FNL90_00685) comGD 104137..104565 (+) 429 WP_047235100.1 competence type IV pilus minor pilin ComGD Machinery gene
  FNL90_RS00675 (FNL90_00690) comGE 104522..104806 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  FNL90_RS00680 (FNL90_00695) comGF 104799..105233 (+) 435 WP_002987783.1 competence type IV pilus minor pilin ComGF Machinery gene
  FNL90_RS00685 (FNL90_00700) comGG 105217..105543 (+) 327 WP_009880358.1 competence type IV pilus minor pilin ComGG -
  FNL90_RS00690 (FNL90_00705) comGH 105641..106594 (+) 954 WP_009880357.1 class I SAM-dependent methyltransferase Machinery gene
  FNL90_RS00695 (FNL90_00710) - 106653..107849 (+) 1197 WP_030126459.1 acetate kinase -
  FNL90_RS00700 (FNL90_00715) - 108035..108343 (+) 309 Protein_90 hypothetical protein -
  FNL90_RS00705 (FNL90_00720) proC 108426..109196 (-) 771 WP_009880354.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=325836 FNL90_RS00675 WP_011284422.1 104522..104806(+) (comGE) [Streptococcus pyogenes strain 37-97S]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=325836 FNL90_RS00675 WP_011284422.1 104522..104806(+) (comGE) [Streptococcus pyogenes strain 37-97S]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment