Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | BCAH820_RS11005 | Genome accession | NC_011773 |
| Coordinates | 2077978..2078316 (+) | Length | 112 a.a. |
| NCBI ID | WP_000982005.1 | Uniprot ID | B7JLM0 |
| Organism | Bacillus cereus AH820 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2077673..2131725 | 2077978..2078316 | within | 0 |
Gene organization within MGE regions
Location: 2077673..2131725
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BCAH820_RS11005 (BCAH820_2193) | ssb | 2077978..2078316 (+) | 339 | WP_000982005.1 | single-stranded DNA-binding protein | Machinery gene |
| BCAH820_RS11010 (BCAH820_2194) | - | 2078446..2079573 (+) | 1128 | WP_000692552.1 | conserved virulence factor C family protein | - |
| BCAH820_RS11015 (BCAH820_2195) | - | 2079577..2079960 (+) | 384 | WP_000634871.1 | thiol-disulfide oxidoreductase DCC family protein | - |
| BCAH820_RS11020 (BCAH820_2196) | - | 2080044..2080478 (+) | 435 | WP_000063710.1 | BrxA/BrxB family bacilliredoxin | - |
| BCAH820_RS11025 (BCAH820_2197) | - | 2080528..2081304 (+) | 777 | WP_000637475.1 | class I SAM-dependent methyltransferase | - |
| BCAH820_RS11030 (BCAH820_2198) | argS | 2081603..2083291 (+) | 1689 | WP_000385007.1 | arginine--tRNA ligase | - |
| BCAH820_RS11035 (BCAH820_2199) | - | 2083467..2084345 (+) | 879 | WP_000451270.1 | class I SAM-dependent methyltransferase | - |
| BCAH820_RS11040 (BCAH820_2200) | - | 2084715..2088917 (+) | 4203 | WP_000883810.1 | bacteriocin-processing peptidase family protein | - |
| BCAH820_RS11045 (BCAH820_2201) | ileS | 2089309..2092410 (+) | 3102 | WP_000754910.1 | isoleucine--tRNA ligase | - |
| BCAH820_RS11050 (BCAH820_2202) | - | 2092731..2094242 (+) | 1512 | WP_000482297.1 | M36 family metallopeptidase | - |
| BCAH820_RS11055 (BCAH820_2203) | - | 2094346..2094828 (-) | 483 | WP_000709325.1 | hypothetical protein | - |
| BCAH820_RS11060 (BCAH820_2204) | - | 2094892..2095419 (+) | 528 | Protein_2096 | Mur ligase family protein | - |
| BCAH820_RS11065 (BCAH820_2205) | aspS | 2095870..2097168 (+) | 1299 | WP_000529811.1 | aspartate--tRNA(Asn) ligase | - |
| BCAH820_RS11070 (BCAH820_2206) | - | 2097369..2098133 (+) | 765 | WP_000966846.1 | vWA domain-containing protein | - |
| BCAH820_RS11075 (BCAH820_2207) | - | 2098145..2098918 (+) | 774 | WP_000241763.1 | protein phosphatase 2C domain-containing protein | - |
| BCAH820_RS11080 (BCAH820_2208) | - | 2098947..2099309 (+) | 363 | WP_000391132.1 | EsaB/YukD family protein | - |
| BCAH820_RS11085 (BCAH820_2209) | essC | 2099341..2103348 (+) | 4008 | WP_001172768.1 | type VII secretion protein EssC | - |
| BCAH820_RS11090 (BCAH820_2210) | - | 2103476..2103748 (+) | 273 | WP_000807831.1 | WXG100 family type VII secretion target | - |
| BCAH820_RS11095 (BCAH820_2211) | - | 2103832..2106507 (+) | 2676 | WP_000506924.1 | tetratricopeptide repeat protein | - |
| BCAH820_RS31050 (BCAH820_2212) | - | 2106531..2109266 (+) | 2736 | WP_000392230.1 | hypothetical protein | - |
| BCAH820_RS11105 (BCAH820_2213) | - | 2109337..2109774 (+) | 438 | WP_001050360.1 | SseB family protein | - |
| BCAH820_RS11110 (BCAH820_2214) | - | 2109831..2111219 (+) | 1389 | WP_000404138.1 | WXG100 family type VII secretion target | - |
| BCAH820_RS11115 (BCAH820_2215) | - | 2111232..2111702 (+) | 471 | WP_000449604.1 | immunity protein YezG family protein | - |
| BCAH820_RS32070 | - | 2112133..2112484 (+) | 352 | Protein_2108 | hypothetical protein | - |
| BCAH820_RS32075 (BCAH820_2216) | - | 2112482..2112880 (+) | 399 | WP_396021589.1 | hypothetical protein | - |
| BCAH820_RS11130 (BCAH820_2217) | - | 2112888..2113280 (+) | 393 | WP_000997785.1 | immunity 22 family protein | - |
| BCAH820_RS31355 (BCAH820_2218) | - | 2113396..2113578 (+) | 183 | WP_003299547.1 | hypothetical protein | - |
| BCAH820_RS11135 (BCAH820_2219) | - | 2113616..2114020 (+) | 405 | WP_000414707.1 | immunity 22 family protein | - |
| BCAH820_RS31055 | - | 2114550..2114876 (+) | 327 | Protein_2113 | hypothetical protein | - |
| BCAH820_RS31060 | - | 2115000..2115269 (+) | 270 | WP_269667704.1 | HNH/ENDO VII family nuclease | - |
| BCAH820_RS11155 (BCAH820_2221) | - | 2115285..2115734 (+) | 450 | WP_001030889.1 | SMI1/KNR4 family protein | - |
| BCAH820_RS11160 (BCAH820_2222) | - | 2116496..2117281 (+) | 786 | WP_000412789.1 | recombinase family protein | - |
| BCAH820_RS11165 (BCAH820_2223) | - | 2117438..2118676 (+) | 1239 | WP_000551891.1 | IS110 family transposase | - |
| BCAH820_RS31670 (BCAH820_2224) | - | 2118931..2119167 (+) | 237 | WP_000788962.1 | hypothetical protein | - |
| BCAH820_RS11175 (BCAH820_2225) | - | 2119226..2119924 (+) | 699 | WP_000435837.1 | SMI1/KNR4 family protein | - |
| BCAH820_RS11180 (BCAH820_2226) | - | 2120353..2121045 (+) | 693 | WP_000378749.1 | DNA/RNA non-specific endonuclease | - |
| BCAH820_RS11185 (BCAH820_2227) | - | 2121051..2121539 (+) | 489 | WP_000410097.1 | antitoxin YezG family protein | - |
| BCAH820_RS31675 | - | 2121948..2122262 (+) | 315 | Protein_2122 | WXG100 family type VII secretion target | - |
| BCAH820_RS31680 (BCAH820_2229) | - | 2122547..2122714 (+) | 168 | WP_003287960.1 | hypothetical protein | - |
| BCAH820_RS11200 (BCAH820_2230) | imm47 | 2122719..2123531 (+) | 813 | WP_000862544.1 | Imm47 family immunity protein | - |
| BCAH820_RS31685 (BCAH820_2231) | - | 2123716..2123898 (+) | 183 | WP_079994270.1 | hypothetical protein | - |
| BCAH820_RS11205 | - | 2123974..2124548 (+) | 575 | Protein_2126 | pre-toxin TG domain-containing protein | - |
| BCAH820_RS29840 (BCAH820_2233) | - | 2124606..2125052 (+) | 447 | WP_003297428.1 | hypothetical protein | - |
| BCAH820_RS11215 (BCAH820_2234) | - | 2125069..2125392 (+) | 324 | WP_000025257.1 | DUF6572 domain-containing protein | - |
| BCAH820_RS11220 (BCAH820_2235) | - | 2125416..2126072 (+) | 657 | WP_000646591.1 | hypothetical protein | - |
| BCAH820_RS11225 (BCAH820_2236) | - | 2126138..2126638 (+) | 501 | Protein_2130 | deaminase domain-containing protein | - |
| BCAH820_RS11230 (BCAH820_2237) | - | 2126665..2127021 (+) | 357 | WP_000656077.1 | Imm3 family immunity protein | - |
| BCAH820_RS11235 (BCAH820_2238) | - | 2127541..2128725 (+) | 1185 | WP_001221978.1 | glycerate kinase | - |
| BCAH820_RS11240 (BCAH820_2239) | - | 2128722..2130143 (+) | 1422 | WP_000570746.1 | SLC13 family permease | - |
| BCAH820_RS11245 (BCAH820_2240) | - | 2130272..2130955 (+) | 684 | WP_000504574.1 | response regulator transcription factor | - |
Sequence
Protein
Download Length: 112 a.a. Molecular weight: 12939.75 Da Isoelectric Point: 9.3587
>NTDB_id=32456 BCAH820_RS11005 WP_000982005.1 2077978..2078316(+) (ssb) [Bacillus cereus AH820]
MMNRVVLIGRLTKDPELYYTKQGVAYARVYVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCTKGSLVGITGRIHTR
NYEDDQGKRIYITEVVIESITFLERRREGASQ
MMNRVVLIGRLTKDPELYYTKQGVAYARVYVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCTKGSLVGITGRIHTR
NYEDDQGKRIYITEVVIESITFLERRREGASQ
Nucleotide
Download Length: 339 bp
>NTDB_id=32456 BCAH820_RS11005 WP_000982005.1 2077978..2078316(+) (ssb) [Bacillus cereus AH820]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGATCCAGAATTATACTACACAAAGCAAGGCGTCGCATATGC
ACGAGTATATGTTGCGGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTCGATTTTATTAATTGTGTCGTAT
GGCGAAAATCGGCTGAGAATGTAACCGAATATTGTACGAAAGGGTCCCTTGTTGGAATTACTGGACGTATTCATACGAGG
AATTACGAGGATGATCAAGGAAAGAGAATATATATAACGGAAGTCGTGATTGAGAGCATTACATTTTTGGAGAGAAGGCG
GGAGGGTGCATCACAATAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGATCCAGAATTATACTACACAAAGCAAGGCGTCGCATATGC
ACGAGTATATGTTGCGGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTCGATTTTATTAATTGTGTCGTAT
GGCGAAAATCGGCTGAGAATGTAACCGAATATTGTACGAAAGGGTCCCTTGTTGGAATTACTGGACGTATTCATACGAGG
AATTACGAGGATGATCAAGGAAAGAGAATATATATAACGGAAGTCGTGATTGAGAGCATTACATTTTTGGAGAGAAGGCG
GGAGGGTGCATCACAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.782 |
100 |
0.571 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
94.643 |
0.563 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
52.212 |
100 |
0.527 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
45.455 |
98.214 |
0.446 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.619 |
93.75 |
0.446 |
| ssbA | Streptococcus mutans UA159 |
43.636 |
98.214 |
0.429 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.818 |
98.214 |
0.411 |