Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | EFV54_RS07585 | Genome accession | NZ_CP033607 |
| Coordinates | 1449729..1450154 (-) | Length | 141 a.a. |
| NCBI ID | WP_010905962.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain IL1403 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1414182..1458059 | 1449729..1450154 | within | 0 |
Gene organization within MGE regions
Location: 1414182..1458059
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EFV54_RS07335 (EFV54_07335) | - | 1414182..1414712 (-) | 531 | WP_010905913.1 | hypothetical protein | - |
| EFV54_RS07355 (EFV54_07355) | - | 1416118..1416897 (-) | 780 | WP_010905917.1 | peptidoglycan amidohydrolase family protein | - |
| EFV54_RS07360 (EFV54_07360) | - | 1416897..1417196 (-) | 300 | WP_010905918.1 | phage holin | - |
| EFV54_RS07365 (EFV54_07365) | - | 1417222..1418784 (-) | 1563 | WP_010905919.1 | BppU family phage baseplate upper protein | - |
| EFV54_RS07370 (EFV54_07370) | - | 1418796..1419020 (-) | 225 | WP_010905920.1 | hemolysin XhlA family protein | - |
| EFV54_RS12620 (EFV54_07375) | - | 1419040..1421472 (-) | 2433 | WP_010905921.1 | hypothetical protein | - |
| EFV54_RS07380 (EFV54_07380) | - | 1421450..1421623 (-) | 174 | WP_010905922.1 | hypothetical protein | - |
| EFV54_RS07385 (EFV54_07385) | - | 1421623..1422744 (-) | 1122 | WP_123174250.1 | hypothetical protein | - |
| EFV54_RS07390 (EFV54_07390) | - | 1422760..1424547 (-) | 1788 | WP_010905924.1 | phage tail protein | - |
| EFV54_RS07395 (EFV54_07395) | - | 1424547..1426082 (-) | 1536 | WP_010905925.1 | distal tail protein Dit | - |
| EFV54_RS07400 (EFV54_07400) | - | 1426085..1431007 (-) | 4923 | WP_010905926.1 | phage tail tape measure protein | - |
| EFV54_RS07405 (EFV54_07405) | - | 1431232..1431651 (-) | 420 | WP_010905927.1 | phage tail assembly chaperone | - |
| EFV54_RS07410 (EFV54_07410) | - | 1431796..1432389 (-) | 594 | WP_010905928.1 | phage tail protein | - |
| EFV54_RS07415 (EFV54_07415) | - | 1432420..1432815 (-) | 396 | WP_010905929.1 | DUF806 family protein | - |
| EFV54_RS07420 (EFV54_07420) | - | 1432812..1433318 (-) | 507 | WP_010905930.1 | HK97 gp10 family phage protein | - |
| EFV54_RS07425 (EFV54_07425) | - | 1433320..1433670 (-) | 351 | WP_010905931.1 | phage head closure protein | - |
| EFV54_RS07430 (EFV54_07430) | - | 1433645..1433968 (-) | 324 | WP_010905932.1 | head-tail connector protein | - |
| EFV54_RS07435 (EFV54_07435) | - | 1433984..1435210 (-) | 1227 | WP_010905933.1 | phage major capsid protein | - |
| EFV54_RS07440 (EFV54_07440) | - | 1435222..1435926 (-) | 705 | WP_002819795.1 | head maturation protease, ClpP-related | - |
| EFV54_RS07445 (EFV54_07445) | - | 1435972..1437150 (-) | 1179 | WP_010905935.1 | phage portal protein | - |
| EFV54_RS07450 (EFV54_07450) | - | 1437147..1437356 (-) | 210 | WP_010905936.1 | DUF1056 family protein | - |
| EFV54_RS07455 (EFV54_07455) | - | 1437325..1439295 (-) | 1971 | WP_164752717.1 | terminase large subunit | - |
| EFV54_RS07460 (EFV54_07460) | - | 1439285..1439758 (-) | 474 | WP_010905938.1 | phage terminase small subunit P27 family | - |
| EFV54_RS07465 (EFV54_07465) | - | 1439887..1440402 (-) | 516 | WP_010905939.1 | HNH endonuclease | - |
| EFV54_RS07470 (EFV54_07470) | - | 1440404..1440625 (-) | 222 | WP_015966776.1 | hypothetical protein | - |
| EFV54_RS07475 (EFV54_07475) | - | 1440857..1441279 (-) | 423 | WP_010905941.1 | RinA family protein | - |
| EFV54_RS07480 (EFV54_07480) | - | 1441357..1441716 (-) | 360 | WP_010905942.1 | hypothetical protein | - |
| EFV54_RS07495 (EFV54_07495) | - | 1442177..1442371 (-) | 195 | WP_010905945.1 | DUF1660 domain-containing protein | - |
| EFV54_RS07500 (EFV54_07500) | - | 1442368..1442511 (-) | 144 | WP_010905946.1 | hypothetical protein | - |
| EFV54_RS07505 (EFV54_07505) | - | 1442530..1442865 (-) | 336 | WP_010905947.1 | DUF1140 family protein | - |
| EFV54_RS07510 (EFV54_07510) | - | 1442887..1443231 (-) | 345 | WP_010905948.1 | hypothetical protein | - |
| EFV54_RS07515 (EFV54_07515) | - | 1443235..1443654 (-) | 420 | WP_010905949.1 | dUTP diphosphatase | - |
| EFV54_RS07520 (EFV54_07520) | - | 1443651..1443938 (-) | 288 | WP_010905950.1 | hypothetical protein | - |
| EFV54_RS07525 (EFV54_07525) | - | 1443935..1444570 (-) | 636 | WP_015966771.1 | DUF1642 domain-containing protein | - |
| EFV54_RS07530 (EFV54_07530) | - | 1444563..1444922 (-) | 360 | WP_010905952.1 | hypothetical protein | - |
| EFV54_RS07535 (EFV54_07535) | - | 1444931..1445440 (-) | 510 | WP_010905953.1 | hypothetical protein | - |
| EFV54_RS07540 (EFV54_07540) | - | 1445455..1446027 (-) | 573 | WP_010905954.1 | DUF658 family protein | - |
| EFV54_RS07545 (EFV54_07545) | - | 1446017..1446196 (-) | 180 | WP_010905696.1 | DUF1497 domain-containing protein | - |
| EFV54_RS07550 (EFV54_07550) | - | 1446218..1446502 (-) | 285 | WP_241152873.1 | hypothetical protein | - |
| EFV54_RS07555 (EFV54_07555) | - | 1446620..1446859 (-) | 240 | WP_010905956.1 | DUF1031 family protein | - |
| EFV54_RS07560 (EFV54_07560) | - | 1446852..1447346 (-) | 495 | WP_010905957.1 | hypothetical protein | - |
| EFV54_RS07565 (EFV54_07565) | - | 1447343..1447717 (-) | 375 | WP_010905958.1 | DUF1064 domain-containing protein | - |
| EFV54_RS07570 (EFV54_07570) | - | 1447698..1447871 (-) | 174 | WP_010905959.1 | hypothetical protein | - |
| EFV54_RS07575 (EFV54_07575) | - | 1447868..1448743 (-) | 876 | WP_227028637.1 | ATP-binding protein | - |
| EFV54_RS07580 (EFV54_07580) | - | 1448762..1449601 (-) | 840 | WP_010905961.1 | phage replisome organiser protein | - |
| EFV54_RS07585 (EFV54_07585) | ssb | 1449729..1450154 (-) | 426 | WP_010905962.1 | single-stranded DNA-binding protein | Machinery gene |
| EFV54_RS07590 (EFV54_07590) | - | 1450147..1450905 (-) | 759 | WP_010905963.1 | Rad52/Rad22 family DNA repair protein | - |
| EFV54_RS07595 (EFV54_07595) | - | 1450914..1451309 (-) | 396 | WP_010905964.1 | hypothetical protein | - |
| EFV54_RS07600 (EFV54_07600) | - | 1451424..1451639 (-) | 216 | WP_010905687.1 | DUF1408 domain-containing protein | - |
| EFV54_RS07605 (EFV54_07605) | - | 1451742..1452017 (+) | 276 | WP_010905686.1 | hypothetical protein | - |
| EFV54_RS07610 (EFV54_07610) | - | 1452014..1452208 (-) | 195 | WP_010905685.1 | hypothetical protein | - |
| EFV54_RS07615 (EFV54_07615) | - | 1452351..1452641 (-) | 291 | WP_010905965.1 | hypothetical protein | - |
| EFV54_RS07620 (EFV54_07620) | - | 1452654..1453364 (-) | 711 | WP_010905966.1 | phage antirepressor Ant | - |
| EFV54_RS07625 (EFV54_07625) | - | 1453378..1453611 (-) | 234 | WP_003131906.1 | helix-turn-helix transcriptional regulator | - |
| EFV54_RS07630 (EFV54_07630) | - | 1453783..1454304 (+) | 522 | WP_010905968.1 | helix-turn-helix domain-containing protein | - |
| EFV54_RS07635 (EFV54_07635) | - | 1454314..1454901 (+) | 588 | WP_010905969.1 | hypothetical protein | - |
| EFV54_RS07640 (EFV54_07640) | - | 1454966..1455817 (+) | 852 | WP_010905970.1 | CD20-like domain-containing protein | - |
| EFV54_RS07645 (EFV54_07645) | - | 1455940..1457019 (+) | 1080 | WP_010905971.1 | site-specific integrase | - |
| EFV54_RS07655 (EFV54_07655) | - | 1457724..1458059 (-) | 336 | WP_003130477.1 | putative DNA-binding protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15701.41 Da Isoelectric Point: 5.1972
>NTDB_id=324369 EFV54_RS07585 WP_010905962.1 1449729..1450154(-) (ssb) [Lactococcus lactis strain IL1403]
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYVTEVIANNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYVTEVIANNFQVLEKSNQANGERVSNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=324369 EFV54_RS07585 WP_010905962.1 1449729..1450154(-) (ssb) [Lactococcus lactis strain IL1403]
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATCGGAGTTACTGGTAGTATTCAAACTCGA
AACTACGAGAACCAACAAGGTCAACGAGTTTATGTAACAGAAGTCATTGCAAACAATTTCCAAGTACTTGAAAAAAGCAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATTACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATCGGAGTTACTGGTAGTATTCAAACTCGA
AACTACGAGAACCAACAAGGTCAACGAGTTTATGTAACAGAAGTCATTGCAAACAATTTCCAAGTACTTGAAAAAAGCAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTGCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.118 |
100 |
0.652 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.645 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.681 |
100 |
0.447 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.972 |
100 |
0.44 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
73.759 |
0.433 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.515 |
73.05 |
0.362 |