Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | EEA44_RS04595 | Genome accession | NZ_CP033438 |
| Coordinates | 931180..931626 (+) | Length | 148 a.a. |
| NCBI ID | WP_065124802.1 | Uniprot ID | - |
| Organism | Pediococcus acidilactici strain ATCC 8042 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 921283..970090 | 931180..931626 | within | 0 |
Gene organization within MGE regions
Location: 921283..970090
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EEA44_RS04520 | - | 921283..922458 (-) | 1176 | WP_133279893.1 | tyrosine-type recombinase/integrase | - |
| EEA44_RS04525 | - | 922546..922815 (-) | 270 | WP_133279894.1 | hypothetical protein | - |
| EEA44_RS04530 | - | 922893..923699 (-) | 807 | WP_207920878.1 | hypothetical protein | - |
| EEA44_RS04535 | - | 923680..923910 (+) | 231 | WP_133279896.1 | 2-hydroxymuconic semialdehyde hydrolase | - |
| EEA44_RS04540 | - | 923995..924987 (-) | 993 | WP_159225409.1 | hypothetical protein | - |
| EEA44_RS04545 | - | 925044..925709 (-) | 666 | WP_133279898.1 | LexA family protein | - |
| EEA44_RS04550 | - | 925851..926114 (+) | 264 | WP_229038662.1 | helix-turn-helix transcriptional regulator | - |
| EEA44_RS04555 | - | 926111..926326 (+) | 216 | WP_133279899.1 | hypothetical protein | - |
| EEA44_RS04560 | - | 926411..926875 (+) | 465 | WP_232621116.1 | helix-turn-helix domain-containing protein | - |
| EEA44_RS04565 | - | 926876..927157 (+) | 282 | WP_133279900.1 | hypothetical protein | - |
| EEA44_RS09780 | - | 927159..927302 (+) | 144 | WP_159225408.1 | hypothetical protein | - |
| EEA44_RS04570 | - | 927489..928382 (+) | 894 | WP_133279901.1 | DUF1351 domain-containing protein | - |
| EEA44_RS04575 | - | 928385..929224 (+) | 840 | WP_133279902.1 | ERF family protein | - |
| EEA44_RS04580 | - | 929217..930098 (+) | 882 | WP_133279903.1 | helix-turn-helix domain-containing protein | - |
| EEA44_RS04585 | - | 930103..930825 (+) | 723 | WP_133279904.1 | putative HNHc nuclease | - |
| EEA44_RS04590 | - | 930770..931177 (+) | 408 | WP_133279905.1 | hypothetical protein | - |
| EEA44_RS04595 | ssb | 931180..931626 (+) | 447 | WP_065124802.1 | single-stranded DNA-binding protein | Machinery gene |
| EEA44_RS04600 | - | 931637..931984 (+) | 348 | WP_065124801.1 | DUF1642 domain-containing protein | - |
| EEA44_RS04605 | - | 931981..932205 (+) | 225 | WP_065124800.1 | hypothetical protein | - |
| EEA44_RS09785 | - | 932225..932383 (+) | 159 | WP_153903504.1 | hypothetical protein | - |
| EEA44_RS04610 | - | 932723..933160 (+) | 438 | WP_159208620.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EEA44_RS04620 | - | 933759..934427 (+) | 669 | WP_065124798.1 | hypothetical protein | - |
| EEA44_RS09880 | - | 934496..935185 (+) | 690 | WP_232621117.1 | terminase gpP N-terminus-related DNA-binding protein | - |
| EEA44_RS04630 | - | 935172..936479 (+) | 1308 | WP_133279907.1 | PBSX family phage terminase large subunit | - |
| EEA44_RS04635 | - | 936543..938045 (+) | 1503 | WP_232621118.1 | phage portal protein | - |
| EEA44_RS04640 | - | 938042..939175 (+) | 1134 | WP_133279909.1 | phage minor capsid protein | - |
| EEA44_RS04645 | - | 939272..939829 (+) | 558 | WP_133279910.1 | phage scaffolding protein | - |
| EEA44_RS04650 | - | 939841..940737 (+) | 897 | WP_133279911.1 | hypothetical protein | - |
| EEA44_RS04655 | - | 940809..941228 (+) | 420 | WP_133279912.1 | hypothetical protein | - |
| EEA44_RS04660 | - | 941225..941575 (+) | 351 | WP_133279913.1 | putative minor capsid protein | - |
| EEA44_RS04665 | - | 941575..941919 (+) | 345 | WP_133279914.1 | minor capsid protein | - |
| EEA44_RS04670 | - | 941919..942311 (+) | 393 | WP_133279915.1 | phage tail terminator protein | - |
| EEA44_RS04675 | - | 942324..942866 (+) | 543 | WP_232621119.1 | phage tail tube protein | - |
| EEA44_RS04680 | - | 942940..943407 (+) | 468 | WP_133279916.1 | Ig-like domain-containing protein | - |
| EEA44_RS04685 | - | 943483..943869 (+) | 387 | WP_133279917.1 | hypothetical protein | - |
| EEA44_RS04690 | - | 943879..944499 (+) | 621 | WP_133279918.1 | Gp15 family bacteriophage protein | - |
| EEA44_RS09800 | - | 944533..950154 (+) | 5622 | WP_159225406.1 | tape measure protein | - |
| EEA44_RS04700 | - | 950156..950980 (+) | 825 | WP_133279919.1 | phage tail domain-containing protein | - |
| EEA44_RS04705 | - | 950993..952108 (+) | 1116 | WP_133279920.1 | prophage endopeptidase tail family protein | - |
| EEA44_RS04710 | - | 952101..952352 (+) | 252 | WP_133279921.1 | hypothetical protein | - |
| EEA44_RS04715 | - | 952345..952623 (+) | 279 | WP_159225405.1 | hypothetical protein | - |
| EEA44_RS04720 | - | 952625..953374 (+) | 750 | WP_198465265.1 | hypothetical protein | - |
| EEA44_RS04725 | - | 953387..954850 (+) | 1464 | WP_133279923.1 | hypothetical protein | - |
| EEA44_RS09805 | - | 954862..955020 (+) | 159 | WP_159225404.1 | hypothetical protein | - |
| EEA44_RS04730 | - | 955020..955166 (+) | 147 | WP_133279924.1 | XkdX family protein | - |
| EEA44_RS04735 | - | 955209..955499 (+) | 291 | WP_232621120.1 | hypothetical protein | - |
| EEA44_RS04740 | - | 955499..955753 (+) | 255 | WP_133279926.1 | phage holin | - |
| EEA44_RS04745 | - | 955737..956858 (+) | 1122 | WP_133279927.1 | peptidoglycan recognition protein family protein | - |
| EEA44_RS04750 | - | 956968..957234 (+) | 267 | WP_133279928.1 | hypothetical protein | - |
| EEA44_RS04755 | dnaG | 958049..959905 (+) | 1857 | WP_002830330.1 | DNA primase | - |
| EEA44_RS04760 | rpoD | 959923..961062 (+) | 1140 | WP_002830329.1 | RNA polymerase sigma factor RpoD | - |
| EEA44_RS04765 | - | 961158..961868 (+) | 711 | WP_002830328.1 | tRNA (adenine(22)-N(1))-methyltransferase | - |
| EEA44_RS04770 | - | 961846..962637 (+) | 792 | WP_004165938.1 | Nif3-like dinuclear metal center hexameric protein | - |
| EEA44_RS04775 | clpB | 962649..965252 (+) | 2604 | WP_133279929.1 | ATP-dependent chaperone ClpB | - |
| EEA44_RS04780 | - | 965360..965536 (-) | 177 | WP_002831889.1 | YjzD family protein | - |
| EEA44_RS04785 | dnaE | 965663..968998 (+) | 3336 | WP_119178945.1 | DNA polymerase III subunit alpha | - |
| EEA44_RS04790 | pfkA | 969122..970090 (+) | 969 | WP_002830324.1 | 6-phosphofructokinase | - |
Sequence
Protein
Download Length: 148 a.a. Molecular weight: 16646.32 Da Isoelectric Point: 5.7209
>NTDB_id=323742 EEA44_RS04595 WP_065124802.1 931180..931626(+) (ssb) [Pediococcus acidilactici strain ATCC 8042]
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENFCNFTHKGSLVGIDGRIQTS
SYEKEGQRVYATQVVVDSFSLLEPKQQSQQRGQQSNASDALHNNFGQPTNNYSQNNNDFGIDDNDLPF
MINRTVLVGRLTKDPEIRYTQSGMAVANFTMAVNRQFTNANGEREADFISCIVWRKAAENFCNFTHKGSLVGIDGRIQTS
SYEKEGQRVYATQVVVDSFSLLEPKQQSQQRGQQSNASDALHNNFGQPTNNYSQNNNDFGIDDNDLPF
Nucleotide
Download Length: 447 bp
>NTDB_id=323742 EEA44_RS04595 WP_065124802.1 931180..931626(+) (ssb) [Pediococcus acidilactici strain ATCC 8042]
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGGCAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTCTGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGATGGTCGGATTCAAACTAGT
TCGTACGAAAAGGAAGGTCAACGCGTGTATGCTACACAAGTGGTTGTAGATAGTTTCTCGTTGCTTGAACCAAAGCAACA
AAGCCAACAACGTGGCCAGCAATCCAACGCTAGCGATGCTTTGCATAACAATTTCGGACAACCTACTAACAATTATAGCC
AGAATAATAACGATTTCGGCATCGACGATAATGATTTGCCGTTTTAG
ATGATTAATCGAACCGTATTAGTCGGACGCCTAACCAAGGATCCAGAAATCCGTTATACCCAATCAGGGATGGCGGTGGC
CAACTTTACTATGGCCGTGAACCGGCAGTTCACCAACGCTAATGGCGAGCGAGAAGCGGACTTTATCAGCTGTATTGTCT
GGAGAAAGGCGGCCGAAAACTTCTGTAATTTTACCCACAAAGGATCATTGGTCGGGATTGATGGTCGGATTCAAACTAGT
TCGTACGAAAAGGAAGGTCAACGCGTGTATGCTACACAAGTGGTTGTAGATAGTTTCTCGTTGCTTGAACCAAAGCAACA
AAGCCAACAACGTGGCCAGCAATCCAACGCTAGCGATGCTTTGCATAACAATTTCGGACAACCTACTAACAATTATAGCC
AGAATAATAACGATTTCGGCATCGACGATAATGATTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
54.706 |
100 |
0.628 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
48.837 |
100 |
0.568 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.455 |
74.324 |
0.412 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.514 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.838 |
100 |
0.378 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.838 |
100 |
0.378 |
| ssb | Vibrio cholerae strain A1552 |
31.977 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.162 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.162 |
100 |
0.372 |