Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO217_RS07550 | Genome accession | NZ_CP038461 |
| Coordinates | 1586048..1586359 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472257.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain O217 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1581048..1591359
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO217_RS07515 (SaO217_1453) | gcvPA | 1581550..1582896 (-) | 1347 | WP_000019697.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO217_RS07520 (SaO217_1454) | gcvT | 1582916..1584007 (-) | 1092 | WP_000093347.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO217_RS07525 (SaO217_1455) | - | 1584166..1584690 (-) | 525 | WP_001015125.1 | shikimate kinase | - |
| SaO217_RS07530 | - | 1584680..1584826 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO217_RS07535 (SaO217_1456) | comGF | 1584923..1585420 (-) | 498 | WP_001794328.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO217_RS07540 (SaO217_1457) | comGE | 1585338..1585637 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SaO217_RS07545 (SaO217_1458) | comGD | 1585624..1586070 (-) | 447 | WP_001791207.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO217_RS07550 (SaO217_1459) | comGC | 1586048..1586359 (-) | 312 | WP_000472257.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO217_RS07555 (SaO217_1460) | comGB | 1586373..1587443 (-) | 1071 | WP_000776412.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO217_RS07560 (SaO217_1461) | comGA | 1587415..1588389 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO217_RS07565 | - | 1588441..1589064 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO217_RS07570 (SaO217_1463) | - | 1589061..1589390 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO217_RS07575 | - | 1589390..1590376 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| SaO217_RS07580 (SaO217_1465) | - | 1590373..1590576 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11373.39 Da Isoelectric Point: 7.8600
>NTDB_id=315166 SaO217_RS07550 WP_000472257.1 1586048..1586359(-) (comGC) [Staphylococcus aureus strain O217]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEEQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=315166 SaO217_RS07550 WP_000472257.1 1586048..1586359(-) (comGC) [Staphylococcus aureus strain O217]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGAGCAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus N315 |
99.029 |
100 |
0.99 |
| comGC | Staphylococcus aureus MW2 |
99.029 |
100 |
0.99 |
| comGC/cglC | Streptococcus mitis SK321 |
48.039 |
99.029 |
0.476 |
| comGC/cglC | Streptococcus pneumoniae R6 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae D39 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
47.059 |
99.029 |
0.466 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
52.326 |
83.495 |
0.437 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Streptococcus mutans UA140 |
50 |
73.786 |
0.369 |
| comGC | Streptococcus mutans UA159 |
50 |
73.786 |
0.369 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |