Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | SaO331_RS07605 | Genome accession | NZ_CP038269 |
| Coordinates | 1538875..1539186 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain O331 isolate B114 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1533875..1544186
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SaO331_RS07570 (SaO331_1395) | gcvPA | 1534377..1535723 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| SaO331_RS07575 (SaO331_1396) | gcvT | 1535743..1536834 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| SaO331_RS07580 (SaO331_1397) | - | 1536993..1537517 (-) | 525 | WP_001015116.1 | shikimate kinase | - |
| SaO331_RS07585 | - | 1537507..1537653 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| SaO331_RS07590 (SaO331_1398) | comGF | 1537750..1538247 (-) | 498 | WP_001838632.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| SaO331_RS07595 (SaO331_1399) | comGE | 1538165..1538464 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| SaO331_RS07600 (SaO331_1400) | comGD | 1538451..1538897 (-) | 447 | WP_001796473.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| SaO331_RS07605 (SaO331_1401) | comGC | 1538875..1539186 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| SaO331_RS07610 (SaO331_1402) | comGB | 1539200..1540270 (-) | 1071 | WP_000776407.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| SaO331_RS07615 (SaO331_1403) | comGA | 1540242..1541216 (-) | 975 | WP_000697218.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| SaO331_RS07620 (SaO331_1404) | - | 1541268..1541891 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| SaO331_RS07625 (SaO331_1405) | - | 1541888..1542217 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| SaO331_RS07630 (SaO331_1406) | - | 1542217..1543203 (-) | 987 | WP_000161315.1 | ROK family glucokinase | - |
| SaO331_RS07635 | - | 1543200..1543403 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=310706 SaO331_RS07605 WP_000472256.1 1538875..1539186(-) (comGC) [Staphylococcus aureus strain O331 isolate B114]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=310706 SaO331_RS07605 WP_000472256.1 1538875..1539186(-) (comGC) [Staphylococcus aureus strain O331 isolate B114]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |