Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DNH96_RS11015 | Genome accession | NZ_CP030715 |
| Coordinates | 2284052..2284483 (+) | Length | 143 a.a. |
| NCBI ID | WP_096533902.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain VB88 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2275553..2317530 | 2284052..2284483 | within | 0 |
Gene organization within MGE regions
Location: 2275553..2317530
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DNH96_RS10935 (DNH96_10980) | sufU | 2275553..2276002 (+) | 450 | WP_014614444.1 | Fe-S cluster assembly sulfur transfer protein SufU | - |
| DNH96_RS10940 (DNH96_10985) | sufB | 2276100..2277497 (+) | 1398 | WP_014614443.1 | Fe-S cluster assembly protein SufB | - |
| DNH96_RS10945 (DNH96_10990) | - | 2277565..2278614 (-) | 1050 | WP_096533923.1 | site-specific integrase | - |
| DNH96_RS10950 (DNH96_10995) | - | 2278675..2279112 (-) | 438 | WP_096533921.1 | hypothetical protein | - |
| DNH96_RS10955 | - | 2279125..2279292 (-) | 168 | WP_019165842.1 | hypothetical protein | - |
| DNH96_RS10960 (DNH96_11000) | - | 2279304..2279996 (-) | 693 | WP_096533919.1 | XRE family transcriptional regulator | - |
| DNH96_RS10965 (DNH96_11005) | - | 2280191..2280406 (+) | 216 | WP_065354506.1 | transcriptional regulator | - |
| DNH96_RS10970 (DNH96_11010) | - | 2280421..2280615 (+) | 195 | WP_096533917.1 | hypothetical protein | - |
| DNH96_RS10975 (DNH96_11015) | - | 2280681..2281169 (-) | 489 | WP_096533915.1 | hypothetical protein | - |
| DNH96_RS10980 (DNH96_11020) | - | 2281226..2281948 (+) | 723 | WP_096533913.1 | BRO family protein | - |
| DNH96_RS10985 (DNH96_11025) | - | 2281945..2282169 (+) | 225 | WP_015728800.1 | hypothetical protein | - |
| DNH96_RS10990 | - | 2282157..2282327 (+) | 171 | WP_181397769.1 | hypothetical protein | - |
| DNH96_RS10995 (DNH96_11030) | - | 2282416..2282676 (+) | 261 | WP_096533911.1 | DUF1108 family protein | - |
| DNH96_RS11000 (DNH96_11035) | - | 2282688..2282906 (+) | 219 | WP_096533909.1 | hypothetical protein | - |
| DNH96_RS11005 (DNH96_11040) | - | 2282899..2283384 (+) | 486 | WP_096533907.1 | siphovirus Gp157 family protein | - |
| DNH96_RS11010 (DNH96_11045) | - | 2283381..2284052 (+) | 672 | WP_096533905.1 | ERF family protein | - |
| DNH96_RS11015 (DNH96_11050) | ssbA | 2284052..2284483 (+) | 432 | WP_096533902.1 | single-stranded DNA-binding protein | Machinery gene |
| DNH96_RS11020 (DNH96_11060) | - | 2284667..2285335 (+) | 669 | WP_096533898.1 | putative HNHc nuclease | - |
| DNH96_RS11025 (DNH96_11065) | - | 2285351..2285833 (-) | 483 | WP_096533897.1 | hypothetical protein | - |
| DNH96_RS11030 (DNH96_11070) | - | 2285877..2286641 (+) | 765 | WP_096533896.1 | conserved phage C-terminal domain-containing protein | - |
| DNH96_RS11035 (DNH96_11075) | - | 2286651..2287424 (+) | 774 | WP_096533895.1 | ATP-binding protein | - |
| DNH96_RS11040 (DNH96_11080) | - | 2287418..2287597 (+) | 180 | WP_096533894.1 | hypothetical protein | - |
| DNH96_RS11045 (DNH96_11085) | - | 2287598..2288032 (+) | 435 | WP_096533893.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DNH96_RS11050 (DNH96_11090) | - | 2288016..2288234 (+) | 219 | WP_096533892.1 | hypothetical protein | - |
| DNH96_RS11055 (DNH96_11095) | - | 2288247..2288567 (+) | 321 | WP_096533891.1 | hypothetical protein | - |
| DNH96_RS11060 | - | 2288564..2288728 (+) | 165 | WP_179292374.1 | hypothetical protein | - |
| DNH96_RS11065 (DNH96_11100) | - | 2288728..2289180 (+) | 453 | WP_096533890.1 | DUF3310 domain-containing protein | - |
| DNH96_RS11070 (DNH96_11105) | - | 2289177..2290136 (+) | 960 | WP_096533889.1 | DNA cytosine methyltransferase | - |
| DNH96_RS11075 | - | 2290207..2290383 (+) | 177 | WP_019169002.1 | hypothetical protein | - |
| DNH96_RS11080 (DNH96_11110) | - | 2290383..2290769 (+) | 387 | WP_238399801.1 | hypothetical protein | - |
| DNH96_RS11085 (DNH96_11120) | - | 2290985..2291164 (+) | 180 | WP_096533886.1 | hypothetical protein | - |
| DNH96_RS11090 | - | 2291165..2291320 (+) | 156 | WP_179292373.1 | hypothetical protein | - |
| DNH96_RS11095 | - | 2291321..2291482 (+) | 162 | WP_179292372.1 | hypothetical protein | - |
| DNH96_RS11100 (DNH96_11125) | - | 2291506..2291772 (+) | 267 | WP_037543610.1 | hypothetical protein | - |
| DNH96_RS11105 (DNH96_11130) | - | 2291774..2292145 (+) | 372 | WP_096533174.1 | hypothetical protein | - |
| DNH96_RS11110 (DNH96_11135) | - | 2292164..2292693 (+) | 530 | Protein_2168 | dUTP diphosphatase | - |
| DNH96_RS11115 (DNH96_11140) | - | 2292730..2293194 (+) | 465 | WP_242441896.1 | class I SAM-dependent methyltransferase | - |
| DNH96_RS11120 (DNH96_11145) | - | 2293191..2293379 (+) | 189 | WP_189908851.1 | DUF1381 domain-containing protein | - |
| DNH96_RS11125 (DNH96_11150) | rinB | 2293395..2293565 (+) | 171 | WP_096533881.1 | transcriptional activator RinB | - |
| DNH96_RS11130 | - | 2293565..2293717 (+) | 153 | WP_179292371.1 | hypothetical protein | - |
| DNH96_RS11135 (DNH96_11155) | - | 2293720..2294139 (+) | 420 | WP_065354588.1 | transcriptional regulator | - |
| DNH96_RS11140 (DNH96_11160) | - | 2294338..2294565 (+) | 228 | WP_096533880.1 | hypothetical protein | - |
| DNH96_RS11145 (DNH96_11165) | - | 2294635..2295078 (+) | 444 | WP_096533879.1 | terminase small subunit | - |
| DNH96_RS11150 (DNH96_11170) | - | 2295065..2296339 (+) | 1275 | WP_096533878.1 | PBSX family phage terminase large subunit | - |
| DNH96_RS11155 (DNH96_11175) | - | 2296351..2297796 (+) | 1446 | WP_096533877.1 | phage portal protein | - |
| DNH96_RS11160 (DNH96_11180) | - | 2297789..2299141 (+) | 1353 | WP_096533932.1 | minor capsid protein | - |
| DNH96_RS11165 (DNH96_11185) | - | 2299138..2299332 (+) | 195 | WP_096533876.1 | LSM domain protein | - |
| DNH96_RS11170 (DNH96_11190) | - | 2299484..2300092 (+) | 609 | WP_096533875.1 | DUF4355 domain-containing protein | - |
| DNH96_RS11175 (DNH96_11195) | - | 2300110..2301021 (+) | 912 | WP_096533874.1 | capsid protein | - |
| DNH96_RS11180 (DNH96_11200) | - | 2301111..2301560 (+) | 450 | WP_096533873.1 | Ig-like domain-containing protein | - |
| DNH96_RS11185 (DNH96_11205) | - | 2301572..2301904 (+) | 333 | WP_096533872.1 | phage head-tail connector protein | - |
| DNH96_RS11190 (DNH96_11210) | - | 2301901..2302215 (+) | 315 | WP_060830212.1 | hypothetical protein | - |
| DNH96_RS11195 (DNH96_11215) | - | 2302205..2302555 (+) | 351 | WP_096533871.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DNH96_RS11200 (DNH96_11220) | - | 2302567..2302962 (+) | 396 | WP_096533870.1 | hypothetical protein | - |
| DNH96_RS11205 (DNH96_11225) | - | 2302980..2303633 (+) | 654 | WP_096533869.1 | phage major tail protein, TP901-1 family | - |
| DNH96_RS11210 (DNH96_11230) | - | 2303693..2304073 (+) | 381 | WP_096533868.1 | tail assembly chaperone | - |
| DNH96_RS11215 (DNH96_11235) | - | 2304103..2304453 (+) | 351 | WP_096533867.1 | hypothetical protein | - |
| DNH96_RS11220 (DNH96_11240) | - | 2304470..2307589 (+) | 3120 | WP_096533866.1 | phage tail protein | - |
| DNH96_RS11225 (DNH96_11245) | - | 2307602..2308534 (+) | 933 | WP_096533865.1 | phage tail family protein | - |
| DNH96_RS11230 (DNH96_11250) | - | 2308547..2309944 (+) | 1398 | WP_096533864.1 | phage tail protein | - |
| DNH96_RS11235 (DNH96_11255) | - | 2309948..2310640 (+) | 693 | WP_096533863.1 | hypothetical protein | - |
| DNH96_RS11240 (DNH96_11260) | - | 2310652..2311695 (+) | 1044 | WP_189908852.1 | SGNH/GDSL hydrolase family protein | - |
| DNH96_RS11245 (DNH96_11265) | - | 2311712..2312983 (+) | 1272 | WP_096533861.1 | phage baseplate upper protein | - |
| DNH96_RS11250 (DNH96_11270) | - | 2313016..2313390 (+) | 375 | WP_096533860.1 | hypothetical protein | - |
| DNH96_RS11255 (DNH96_11275) | - | 2313514..2315403 (+) | 1890 | WP_096533859.1 | glucosaminidase domain-containing protein | - |
| DNH96_RS11260 (DNH96_11280) | - | 2315422..2315676 (+) | 255 | WP_096533858.1 | phage holin | - |
| DNH96_RS11265 (DNH96_11285) | - | 2315689..2316444 (+) | 756 | WP_096533857.1 | CHAP domain-containing protein | - |
| DNH96_RS11270 (DNH96_11290) | - | 2316509..2316859 (-) | 351 | WP_096533856.1 | hypothetical protein | - |
| DNH96_RS13380 (DNH96_11295) | - | 2316856..2317008 (-) | 153 | WP_096533855.1 | ribbon-helix-helix domain-containing protein | - |
| DNH96_RS11280 (DNH96_11300) | - | 2317138..2317530 (+) | 393 | WP_096533854.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 16281.93 Da Isoelectric Point: 4.9331
>NTDB_id=301121 DNH96_RS11015 WP_096533902.1 2284052..2284483(+) (ssbA) [Staphylococcus pseudintermedius strain VB88]
MLNRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDNVQFLESKNNNQSNNQQQRGQAPAQDNPFTNANNPIDIEDEDLPF
MLNRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDNVQFLESKNNNQSNNQQQRGQAPAQDNPFTNANNPIDIEDEDLPF
Nucleotide
Download Length: 432 bp
>NTDB_id=301121 DNH96_RS11015 WP_096533902.1 2284052..2284483(+) (ssbA) [Staphylococcus pseudintermedius strain VB88]
ATGCTCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCGGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAACGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCAAACAACCAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATAATCCGA
TTGACATCGAAGATGAAGATTTACCCTTTTGA
ATGCTCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCGGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAACGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCAAACAACCAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATAATCCGA
TTGACATCGAAGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.233 |
100 |
0.664 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.608 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
74.126 |
0.42 |
| ssbA | Streptococcus mutans UA159 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.161 |
100 |
0.392 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.161 |
100 |
0.392 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.462 |
100 |
0.385 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.462 |
100 |
0.385 |
| ssb | Glaesserella parasuis strain SC1401 |
29.944 |
100 |
0.371 |