Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | DOU32_RS09410 | Genome accession | NZ_CP030045 |
| Coordinates | 1798863..1799138 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain C54 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1745358..1798839 | 1798863..1799138 | flank | 24 |
Gene organization within MGE regions
Location: 1745358..1799138
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DOU32_RS09025 (DOU32_09045) | - | 1745358..1747571 (-) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
| DOU32_RS09030 (DOU32_09050) | - | 1747786..1748538 (-) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| DOU32_RS09035 (DOU32_09055) | prmA | 1748540..1749487 (-) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| DOU32_RS09040 (DOU32_09060) | - | 1749503..1749988 (-) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| DOU32_RS09045 (DOU32_09065) | - | 1749945..1750622 (-) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| DOU32_RS09050 (DOU32_09070) | - | 1750751..1752028 (+) | 1278 | WP_002357069.1 | replication-associated recombination protein A | - |
| DOU32_RS09060 (DOU32_09080) | - | 1752302..1752634 (+) | 333 | WP_002357068.1 | hypothetical protein | - |
| DOU32_RS09070 (DOU32_09090) | - | 1752950..1753423 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| DOU32_RS09075 (DOU32_09095) | - | 1753535..1754722 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| DOU32_RS09080 (DOU32_09100) | - | 1754747..1755754 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| DOU32_RS09085 (DOU32_09105) | comGG | 1755883..1756236 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| DOU32_RS09090 (DOU32_09110) | comGF | 1756236..1756670 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| DOU32_RS09095 (DOU32_09115) | - | 1756660..1756986 (-) | 327 | WP_002393943.1 | type II secretion system protein | - |
| DOU32_RS09100 (DOU32_09120) | - | 1757459..1758418 (+) | 960 | WP_002360751.1 | IS30-like element IS1062 family transposase | - |
| DOU32_RS09110 (DOU32_09130) | hemH | 1758853..1759794 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| DOU32_RS09120 (DOU32_09140) | - | 1760510..1760782 (-) | 273 | WP_002370964.1 | hypothetical protein | - |
| DOU32_RS09125 (DOU32_09145) | - | 1760854..1761054 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| DOU32_RS09130 (DOU32_09150) | - | 1761891..1763137 (-) | 1247 | Protein_1685 | LysM peptidoglycan-binding domain-containing protein | - |
| DOU32_RS09135 (DOU32_09155) | - | 1763138..1763371 (-) | 234 | WP_002384371.1 | phage holin | - |
| DOU32_RS09140 (DOU32_09160) | - | 1763364..1763585 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| DOU32_RS09145 (DOU32_09165) | - | 1763620..1763775 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| DOU32_RS09150 (DOU32_09170) | - | 1763777..1764097 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| DOU32_RS09155 (DOU32_09175) | - | 1764111..1764602 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| DOU32_RS09160 (DOU32_09180) | - | 1764602..1764889 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| DOU32_RS09165 (DOU32_09185) | - | 1764886..1765482 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| DOU32_RS09170 (DOU32_09190) | - | 1765475..1766356 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| DOU32_RS09175 (DOU32_09195) | - | 1766375..1769182 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| DOU32_RS09180 (DOU32_09200) | - | 1769164..1769898 (-) | 735 | WP_002357042.1 | hypothetical protein | - |
| DOU32_RS09185 (DOU32_09205) | - | 1769888..1772785 (-) | 2898 | WP_025187643.1 | tape measure protein | - |
| DOU32_RS09190 (DOU32_09210) | gpG | 1773033..1773383 (-) | 351 | WP_002370959.1 | phage tail assembly chaperone G | - |
| DOU32_RS09195 (DOU32_09215) | - | 1773436..1774284 (-) | 849 | WP_002384363.1 | major tail protein | - |
| DOU32_RS09200 (DOU32_09220) | - | 1774285..1774659 (-) | 375 | WP_002357037.1 | phage tail terminator family protein | - |
| DOU32_RS09205 (DOU32_09225) | - | 1774662..1775060 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| DOU32_RS09210 (DOU32_09230) | - | 1775053..1775421 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| DOU32_RS09215 (DOU32_09235) | - | 1775418..1775762 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| DOU32_RS09220 (DOU32_09240) | - | 1775776..1775958 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| DOU32_RS09225 (DOU32_09245) | - | 1775987..1776874 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| DOU32_RS09230 (DOU32_09250) | - | 1776888..1777511 (-) | 624 | WP_002389133.1 | capsid assembly scaffolding protein Gp46 family protein | - |
| DOU32_RS09235 (DOU32_09255) | - | 1777729..1778049 (-) | 321 | WP_002389265.1 | hypothetical protein | - |
| DOU32_RS09240 (DOU32_09260) | - | 1778114..1778335 (-) | 222 | WP_002357027.1 | hypothetical protein | - |
| DOU32_RS09245 (DOU32_09265) | - | 1778332..1780089 (-) | 1758 | WP_002384360.1 | head protein | - |
| DOU32_RS09250 (DOU32_09270) | - | 1780064..1781551 (-) | 1488 | WP_138818577.1 | phage portal protein | - |
| DOU32_RS09255 (DOU32_09275) | - | 1781563..1782852 (-) | 1290 | WP_002403123.1 | PBSX family phage terminase large subunit | - |
| DOU32_RS09260 (DOU32_09280) | terS | 1782824..1783627 (-) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| DOU32_RS09265 (DOU32_09285) | - | 1783896..1784813 (+) | 918 | WP_002370955.1 | beta family protein | - |
| DOU32_RS09270 (DOU32_09290) | - | 1784851..1785429 (-) | 579 | WP_002370953.1 | sce7726 family protein | - |
| DOU32_RS09275 (DOU32_09295) | - | 1785573..1785806 (-) | 234 | WP_002389079.1 | hypothetical protein | - |
| DOU32_RS09290 (DOU32_09310) | - | 1786800..1787216 (-) | 417 | WP_002389289.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| DOU32_RS09300 (DOU32_09320) | - | 1788123..1788548 (-) | 426 | WP_002389212.1 | RusA family crossover junction endodeoxyribonuclease | - |
| DOU32_RS09305 (DOU32_09325) | - | 1788566..1788865 (-) | 300 | WP_002389080.1 | MazG-like family protein | - |
| DOU32_RS09310 (DOU32_09330) | - | 1788866..1789168 (-) | 303 | WP_002389299.1 | hypothetical protein | - |
| DOU32_RS09315 (DOU32_09335) | - | 1789172..1790173 (-) | 1002 | WP_002389256.1 | Lin1244/Lin1753 domain-containing protein | - |
| DOU32_RS09320 (DOU32_09340) | - | 1790210..1791103 (-) | 894 | WP_002369907.1 | recombinase RecT | - |
| DOU32_RS09325 (DOU32_09345) | - | 1791103..1792047 (-) | 945 | WP_002389314.1 | YqaJ viral recombinase family protein | - |
| DOU32_RS09335 (DOU32_09355) | - | 1792145..1792372 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| DOU32_RS09340 (DOU32_09360) | - | 1792372..1792695 (-) | 324 | WP_002369793.1 | hypothetical protein | - |
| DOU32_RS09345 (DOU32_09365) | - | 1792739..1792924 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| DOU32_RS09350 (DOU32_09370) | - | 1792915..1793109 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| DOU32_RS09355 (DOU32_09375) | - | 1793162..1793344 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| DOU32_RS09360 (DOU32_09380) | - | 1793384..1794106 (-) | 723 | WP_002389018.1 | Rha family transcriptional regulator | - |
| DOU32_RS09365 (DOU32_09385) | - | 1794145..1794462 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| DOU32_RS09370 (DOU32_09390) | - | 1794468..1794659 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| DOU32_RS09380 (DOU32_09400) | - | 1794950..1795294 (+) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| DOU32_RS09385 (DOU32_09405) | - | 1795299..1795946 (+) | 648 | WP_002409785.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DOU32_RS09390 (DOU32_09410) | - | 1796064..1796828 (+) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| DOU32_RS09395 (DOU32_09415) | - | 1796843..1797172 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| DOU32_RS09400 (DOU32_09420) | - | 1797247..1798395 (+) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| DOU32_RS09405 (DOU32_09425) | comGD | 1798423..1798866 (-) | 444 | WP_002356992.1 | competence type IV pilus minor pilin ComGD | - |
| DOU32_RS09410 (DOU32_09430) | comGC/cglC | 1798863..1799138 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=298726 DOU32_RS09410 WP_002356991.1 1798863..1799138(-) (comGC/cglC) [Enterococcus faecalis strain C54]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=298726 DOU32_RS09410 WP_002356991.1 1798863..1799138(-) (comGC/cglC) [Enterococcus faecalis strain C54]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |